Lineage for d1wmxa_ (1wmx A:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 554850Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 554851Superfamily b.18.1: Galactose-binding domain-like [49785] (27 families) (S)
  5. 555229Family b.18.1.24: Family 30 carbohydrate binding module, CBM30 (PKD repeat) [110125] (1 protein)
  6. 555230Protein Endoglucanase CelJ [110126] (1 species)
  7. 555231Species Clostridium thermocellum [TaxId:1515] [110127] (1 PDB entry)
  8. 555232Domain d1wmxa_: 1wmx A: [109418]

Details for d1wmxa_

PDB Entry: 1wmx (more details), 2 Å

PDB Description: Crystal Structure of Family 30 Carbohydrate Binding Module

SCOP Domain Sequences for d1wmxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wmxa_ b.18.1.24 (A:) Endoglucanase CelJ {Clostridium thermocellum}
lldvqifkdspvvgwsgsgmgeletigdtlpvdttvtynglptlrlnvqttvqsgwwisl
ltlrgwnthdlsqyvengylefdikgkeggedfvigfrdkvyervygleidvttvisnyv
tvttdwqhvkiplrdlmkinngfdpssvtclvfskryadpftvwfsdikitse

SCOP Domain Coordinates for d1wmxa_:

Click to download the PDB-style file with coordinates for d1wmxa_.
(The format of our PDB-style files is described here.)

Timeline for d1wmxa_: