SCOP 1.69: Domain d1wmxa_: 1wmx A:

Lineage for d1wmxa_ (1wmx A:)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll

4. Superfamily b.18.1: Galactose-binding domain-like [49785] (24 families)

5. Family b.18.1.24: Family 30 carbohydrate binding module, CBM30 (PKD repeat) [110125] (1 protein)

6. Protein Endoglucanase CelJ [110126] (1 species)

7. Species Clostridium thermocellum [TaxId:1515] [110127] (1 PDB entry)

8. Domain d1wmxa_: 1wmx A: [109418]

Details for d1wmxa_

PDB Entry: 1wmx, 2 Å

PDB Description: Crystal Structure of Family 30 Carbohydrate Binding Module

SCOP Domain Sequences for d1wmxa_:

Sequence; same for both SEQRES and ATOM records:

>d1wmxa_ b.18.1.24 (A:) Endoglucanase CelJ {Clostridium thermocellum}
lldvqifkdspvvgwsgsgmgeletigdtlpvdttvtynglptlrlnvqttvqsgwwisl
ltlrgwnthdlsqyvengylefdikgkeggedfvigfrdkvyervygleidvttvisnyv
tvttdwqhvkiplrdlmkinngfdpssvtclvfskryadpftvwfsdikitse

Timeline for d1wmxa_:

• d1wmxa_ is new in SCOP 1.69
  
• d1wmxa_ appears in SCOP 1.71
  
• d1wmxa_ appears in the current release, SCOPe 2.08