SCOP 1.69: Domain d1wmua_: 1wmu A:

Lineage for d1wmua_ (1wmu A:)

1. Root: SCOP 1.69

2. Class a: All alpha proteins [46456] (218 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (4 families)

5. Family a.1.1.2: Globins [46463] (22 proteins)
   Heme-binding protein

6. Protein Hemoglobin, alpha-chain [46486] (18 species)

7. Species Aldabra giant tortoise (Geochelone gigantea) [TaxId:167804] [100976] (2 PDB entries)

8. Domain d1wmua_: 1wmu A: [109416]
   Other proteins in same PDB: d1wmub_

Details for d1wmua_

PDB Entry: 1wmu, 1.65 Å

PDB Description: Crystal Structure of Hemoglobin D from the Aldabra Giant Tortoise, Geochelone gigantea, at 1.65 A resolution

SCOP Domain Sequences for d1wmua_:

Sequence; same for both SEQRES and ATOM records:

>d1wmua_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Aldabra giant tortoise (Geochelone gigantea)}
mlteddkqliqhvwekvlehqedfgaealermfivypstktyfphfdlhhdseqirhhgk
kvvgalgdavkhidnlsatlselsnlhaynlrvdpvnfkllshcfqvvlgahlgreytpq
vqvaydkflaavsavlaekyr

Timeline for d1wmua_:

• d1wmua_ is new in SCOP 1.69
  
• d1wmua_ appears in SCOP 1.71
  
• d1wmua_ appears in the current release, SCOPe 2.08