Lineage for d1wmsb_ (1wms B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2473887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2473888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2474875Family c.37.1.8: G proteins [52592] (80 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2475706Protein Rab9a [110537] (3 species)
  7. 2475710Species Human (Homo sapiens) [TaxId:9606] [110539] (1 PDB entry)
    Uniprot P51151 2-175 # 100% sequence identity do the dog protein (Uniprot P24408 2-175)
  8. 2475712Domain d1wmsb_: 1wms B: [109415]
    complexed with gdp

Details for d1wmsb_

PDB Entry: 1wms (more details), 1.25 Å

PDB Description: High resolution crystal structure of human Rab9 GTPase: a novel antiviral drug target
PDB Compounds: (B:) Ras-related protein Rab-9A

SCOPe Domain Sequences for d1wmsb_:

Sequence, based on SEQRES records: (download)

>d1wmsb_ c.37.1.8 (B:) Rab9a {Human (Homo sapiens) [TaxId: 9606]}
sslfkvillgdggvgksslmnryvtnkfdtqlfhtigveflnkdlevdghfvtmqiwdta
gqerfrslrtpfyrgsdcclltfsvddsqsfqnlsnwkkefiyyadvkepesfpfvilgn
kidiserqvsteeaqawcrdngdypyfetsakdatnvaaafeeavrrvlat

Sequence, based on observed residues (ATOM records): (download)

>d1wmsb_ c.37.1.8 (B:) Rab9a {Human (Homo sapiens) [TaxId: 9606]}
sslfkvillgdggvgksslmnryvtnkfdttigveflnkdlevdghfvtmqiwdtagqer
frslrtpfyrgsdcclltfsvddsqsfqnlsnwkkefiyyadesfpfvilgnkidiserq
vsteeaqawcrdngdypyfetsakdatnvaaafeeavrrvlat

SCOPe Domain Coordinates for d1wmsb_:

Click to download the PDB-style file with coordinates for d1wmsb_.
(The format of our PDB-style files is described here.)

Timeline for d1wmsb_: