SCOPe 2.08: Domain d1wmsb_: 1wms B:

Lineage for d1wmsb_ (1wms B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (81 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein Rab9a [110537] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [110539] (1 PDB entry)
   Uniprot P51151 2-175 # 100% sequence identity do the dog protein (Uniprot P24408 2-175)

8. Domain d1wmsb_: 1wms B: [109415]
   complexed with gdp

Details for d1wmsb_

PDB Entry: 1wms, 1.25 Å

PDB Description: High resolution crystal structure of human Rab9 GTPase: a novel antiviral drug target

PDB Compounds: (B:) Ras-related protein Rab-9A

SCOPe Domain Sequences for d1wmsb_:

Sequence, based on SEQRES records:

>d1wmsb_ c.37.1.8 (B:) Rab9a {Human (Homo sapiens) [TaxId: 9606]}
sslfkvillgdggvgksslmnryvtnkfdtqlfhtigveflnkdlevdghfvtmqiwdta
gqerfrslrtpfyrgsdcclltfsvddsqsfqnlsnwkkefiyyadvkepesfpfvilgn
kidiserqvsteeaqawcrdngdypyfetsakdatnvaaafeeavrrvlat

Sequence, based on observed residues (ATOM records):

>d1wmsb_ c.37.1.8 (B:) Rab9a {Human (Homo sapiens) [TaxId: 9606]}
sslfkvillgdggvgksslmnryvtnkfdttigveflnkdlevdghfvtmqiwdtagqer
frslrtpfyrgsdcclltfsvddsqsfqnlsnwkkefiyyadesfpfvilgnkidiserq
vsteeaqawcrdngdypyfetsakdatnvaaafeeavrrvlat

Timeline for d1wmsb_:

• d1wmsb_ first appeared in SCOP 1.69
  
• d1wmsb_ appears in SCOPe 2.07