Lineage for d1wmsa_ (1wms A:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 483669Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 483670Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (22 families) (S)
    division into families based on beta-sheet topologies
  5. 484126Family c.37.1.8: G proteins [52592] (43 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 484443Protein Rab9a [110537] (2 species)
  7. 484447Species Human (Homo sapiens) [TaxId:9606] [110539] (1 PDB entry)
  8. 484448Domain d1wmsa_: 1wms A: [109414]

Details for d1wmsa_

PDB Entry: 1wms (more details), 1.25 Å

PDB Description: High resolution crystal structure of human Rab9 GTPase: a novel antiviral drug target

SCOP Domain Sequences for d1wmsa_:

Sequence, based on SEQRES records: (download)

>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens)}
agksslfkvillgdggvgksslmnryvtnkfdtqlfhtigveflnkdlevdghfvtmqiw
dtagqerfrslrtpfyrgsdcclltfsvddsqsfqnlsnwkkefiyyadvkepesfpfvi
lgnkidiserqvsteeaqawcrdngdypyfetsakdatnvaaafeeavrrvlat

Sequence, based on observed residues (ATOM records): (download)

>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens)}
agksslfkvillgdggvgksslmnryvtnkfdttigveflnkdlevdghfvtmqiwdtag
qerfrslrtpfyrgsdcclltfsvddsqsfqnlsnwkkefiyyadvkepesfpfvilgnk
idiserqvsteeaqawcrdngdypyfetsakdatnvaaafeeavrrvlat

SCOP Domain Coordinates for d1wmsa_:

Click to download the PDB-style file with coordinates for d1wmsa_.
(The format of our PDB-style files is described here.)

Timeline for d1wmsa_: