Lineage for d1wmfa2 (1wmf A:1-318)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 485773Fold c.41: Subtilisin-like [52742] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 7 strands, order 2314567; left-handed crossover connection between strands 2 & 3
  4. 485774Superfamily c.41.1: Subtilisin-like [52743] (2 families) (S)
  5. 485775Family c.41.1.1: Subtilases [52744] (11 proteins)
  6. 485776Protein Alkaline serine protease kp-43, N-terminal domain [110578] (1 species)
  7. 485777Species Bacillus sp. KSM-KP43 [TaxId:109322] [110579] (3 PDB entries)
  8. 485780Domain d1wmfa2: 1wmf A:1-318 [109413]
    Other proteins in same PDB: d1wmfa1

Details for d1wmfa2

PDB Entry: 1wmf (more details), 1.73 Å

PDB Description: Crystal Structure of alkaline serine protease KP-43 from Bacillus sp. KSM-KP43 (oxidized form, 1.73 angstrom)

SCOP Domain Sequences for d1wmfa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wmfa2 c.41.1.1 (A:1-318) Alkaline serine protease kp-43, N-terminal domain {Bacillus sp. KSM-KP43}
ndvargivkadvaqssyglygqgqivavadtgldtgrndssmheafrgkitalyalgrtn
nandtnghgthvagsvlgngstnkgmapqanlvfqsimdsggglgglpsnlqtlfsqays
agarihtnswgaavngayttdsrnvddyvrkndmtilfaagnegpnggtisapgtaknai
tvgatenlrpsfgsyadninhvaqfssrgptkdgrikpdvmapgtfilsarsslapdssf
wanhdskyaymggtsmatpivagnvaqlrehfvknrgitpkpsllkaaliagaadiglgy
pngnqgwgrvtldkslnv

SCOP Domain Coordinates for d1wmfa2:

Click to download the PDB-style file with coordinates for d1wmfa2.
(The format of our PDB-style files is described here.)

Timeline for d1wmfa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1wmfa1