![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.41: Subtilisin-like [52742] (1 superfamily) 3 layers: a/b/a, parallel beta-sheet of 7 strands, order 2314567; left-handed crossover connection between strands 2 & 3 |
![]() | Superfamily c.41.1: Subtilisin-like [52743] (3 families) ![]() |
![]() | Family c.41.1.1: Subtilases [52744] (15 proteins) |
![]() | Protein Alkaline serine protease kp-43, N-terminal domain [110578] (1 species) |
![]() | Species Bacillus sp. KSM-KP43 [TaxId:109322] [110579] (3 PDB entries) Uniprot Q93UV9 207-640 |
![]() | Domain d1wmfa2: 1wmf A:1-318 [109413] Other proteins in same PDB: d1wmfa1 complexed with ca, dio, gol |
PDB Entry: 1wmf (more details), 1.73 Å
SCOPe Domain Sequences for d1wmfa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wmfa2 c.41.1.1 (A:1-318) Alkaline serine protease kp-43, N-terminal domain {Bacillus sp. KSM-KP43 [TaxId: 109322]} ndvargivkadvaqssyglygqgqivavadtgldtgrndssmheafrgkitalyalgrtn nandtnghgthvagsvlgngstnkgmapqanlvfqsimdsggglgglpsnlqtlfsqays agarihtnswgaavngayttdsrnvddyvrkndmtilfaagnegpnggtisapgtaknai tvgatenlrpsfgsyadninhvaqfssrgptkdgrikpdvmapgtfilsarsslapdssf wanhdskyaymggtsmatpivagnvaqlrehfvknrgitpkpsllkaaliagaadiglgy pngnqgwgrvtldkslnv
Timeline for d1wmfa2: