SCOP 1.71: Domain d1wmea1: 1wme A:319-434

Lineage for d1wmea1 (1wme A:319-434)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll

4. Superfamily b.18.1: Galactose-binding domain-like [49785] (27 families)

5. Family b.18.1.20: Proprotein convertase P-domain [89249] (3 proteins)
   a truncated form of this fold lacking one of the N-terminal strands

6. Protein Alkaline serine protease kp-43, C-terminal domain [110120] (1 species)

7. Species Bacillus sp. KSM-KP43 [TaxId:109322] [110121] (3 PDB entries)

8. Domain d1wmea1: 1wme A:319-434 [109410]
   Other proteins in same PDB: d1wmea2
   complexed with ca

Details for d1wmea1

PDB Entry: 1wme, 1.5 Å

PDB Description: Crystal Structure of alkaline serine protease KP-43 from Bacillus sp. KSM-KP43 (1.50 angstrom, 293 K)

SCOP Domain Sequences for d1wmea1:

Sequence; same for both SEQRES and ATOM records:

>d1wmea1 b.18.1.20 (A:319-434) Alkaline serine protease kp-43, C-terminal domain {Bacillus sp. KSM-KP43}
ayvnessslstsqkatysftatagkplkislvwsdapasttasvtlvndldlvitapngt
qyvgndftspyndnwdgrnnvenvfinapqsgtytievqaynvpvgpqtfslaivn

Timeline for d1wmea1:

• d1wmea1 first appeared in SCOP 1.69
  
• d1wmea1 appears in SCOP 1.73
  
• d1wmea1 appears in the current release, SCOPe 2.08