Lineage for d1wmea1 (1wme A:319-434)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 458865Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 458866Superfamily b.18.1: Galactose-binding domain-like [49785] (24 families) (S)
  5. 459190Family b.18.1.20: Proprotein convertase P-domain [89249] (3 protein domains)
    a truncated form of this fold lacking one of the N-terminal strands
  6. 459191Protein Alkaline serine protease kp-43, C-terminal domain [110120] (1 species)
  7. 459192Species Bacillus sp. KSM-KP43 [TaxId:109322] [110121] (3 PDB entries)
  8. 459194Domain d1wmea1: 1wme A:319-434 [109410]
    Other proteins in same PDB: d1wmea2

Details for d1wmea1

PDB Entry: 1wme (more details), 1.5 Å

PDB Description: Crystal Structure of alkaline serine protease KP-43 from Bacillus sp. KSM-KP43 (1.50 angstrom, 293 K)

SCOP Domain Sequences for d1wmea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wmea1 b.18.1.20 (A:319-434) Alkaline serine protease kp-43, C-terminal domain {Bacillus sp. KSM-KP43}
ayvnessslstsqkatysftatagkplkislvwsdapasttasvtlvndldlvitapngt
qyvgndftspyndnwdgrnnvenvfinapqsgtytievqaynvpvgpqtfslaivn

SCOP Domain Coordinates for d1wmea1:

Click to download the PDB-style file with coordinates for d1wmea1.
(The format of our PDB-style files is described here.)

Timeline for d1wmea1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1wmea2