SCOPe 2.08: Domain d1wmda2: 1wmd A:1-318

Lineage for d1wmda2 (1wmd A:1-318)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.41: Subtilisin-like [52742] (1 superfamily)
   3 layers: a/b/a, parallel beta-sheet of 7 strands, order 2314567; left-handed crossover connection between strands 2 & 3

4. Superfamily c.41.1: Subtilisin-like [52743] (3 families)

5. Family c.41.1.1: Subtilases [52744] (15 proteins)

6. Protein Alkaline serine protease kp-43, N-terminal domain [110578] (1 species)

7. Species Bacillus sp. KSM-KP43 [TaxId:109322] [110579] (3 PDB entries)
   Uniprot Q93UV9 207-640

8. Domain d1wmda2: 1wmd A:1-318 [109409]
   Other proteins in same PDB: d1wmda1
   complexed with ca, dio, gol, so4

Details for d1wmda2

PDB Entry: 1wmd, 1.3 Å

PDB Description: Crystal Structure of alkaline serine protease KP-43 from Bacillus sp. KSM-KP43 (1.30 angstrom, 100 K)

PDB Compounds: (A:) Protease

SCOPe Domain Sequences for d1wmda2:

Sequence; same for both SEQRES and ATOM records:

>d1wmda2 c.41.1.1 (A:1-318) Alkaline serine protease kp-43, N-terminal domain {Bacillus sp. KSM-KP43 [TaxId: 109322]}
ndvargivkadvaqssyglygqgqivavadtgldtgrndssmheafrgkitalyalgrtn
nandtnghgthvagsvlgngstnkgmapqanlvfqsimdsggglgglpsnlqtlfsqays
agarihtnswgaavngayttdsrnvddyvrkndmtilfaagnegpnggtisapgtaknai
tvgatenlrpsfgsyadninhvaqfssrgptkdgrikpdvmapgtfilsarsslapdssf
wanhdskyaymggtsmatpivagnvaqlrehfvknrgitpkpsllkaaliagaadiglgy
pngnqgwgrvtldkslnv

Timeline for d1wmda2:

• d1wmda2 first appeared in SCOP 1.69
  
• d1wmda2 appears in SCOPe 2.07