Class b: All beta proteins [48724] (180 folds) |
Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) |
Family b.18.1.20: Proprotein convertase P-domain [89249] (3 proteins) a truncated form of this fold lacking one of the N-terminal strands |
Protein Alkaline serine protease kp-43, C-terminal domain [110120] (1 species) |
Species Bacillus sp. KSM-KP43 [TaxId:109322] [110121] (3 PDB entries) Uniprot Q93UV9 207-640 |
Domain d1wmda1: 1wmd A:319-434 [109408] Other proteins in same PDB: d1wmda2 complexed with ca, dio, gol, so4 |
PDB Entry: 1wmd (more details), 1.3 Å
SCOPe Domain Sequences for d1wmda1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wmda1 b.18.1.20 (A:319-434) Alkaline serine protease kp-43, C-terminal domain {Bacillus sp. KSM-KP43 [TaxId: 109322]} ayvnessslstsqkatysftatagkplkislvwsdapasttasvtlvndldlvitapngt qyvgndftspyndnwdgrnnvenvfinapqsgtytievqaynvpvgpqtfslaivn
Timeline for d1wmda1: