Lineage for d1wm1a_ (1wm1 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2899459Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2899460Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2900251Family c.69.1.7: Proline iminopeptidase-like [53509] (4 proteins)
  6. 2900252Protein Proline aminopeptidase [81303] (1 species)
  7. 2900253Species Serratia marcescens [TaxId:615] [81304] (2 PDB entries)
    Uniprot O32449
  8. 2900254Domain d1wm1a_: 1wm1 A: [109405]
    complexed with ptb

Details for d1wm1a_

PDB Entry: 1wm1 (more details), 2.1 Å

PDB Description: Crystal Structure of Prolyl Aminopeptidase, Complex with Pro-TBODA
PDB Compounds: (A:) proline iminopeptidase

SCOPe Domain Sequences for d1wm1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wm1a_ c.69.1.7 (A:) Proline aminopeptidase {Serratia marcescens [TaxId: 615]}
lrglypplaaydsgwldtgdghriywelsgnpngkpavfihggpgggisphhrqlfdper
ykvllfdqrgcgrsrphasldnnttwhlvadierlremagveqwlvfggswgstlalaya
qthpervsemvlrgiftlrkqrlhwyyqdgasrffpekwervlsilsdderkdviaayrq
rltsadpqvqleaaklwsvwegetvtllpsresasfgeddfalafarienhyfthlgfle
sddqllrnvplirhipavivhgrydmacqvqnawdlakawpeaelhivegaghsydepgi
lhqlmiatdrfag

SCOPe Domain Coordinates for d1wm1a_:

Click to download the PDB-style file with coordinates for d1wm1a_.
(The format of our PDB-style files is described here.)

Timeline for d1wm1a_: