Lineage for d1wm0x_ (1wm0 X:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 448073Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 448074Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (1 family) (S)
  5. 448075Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (30 proteins)
  6. 448234Protein Peroxisome proliferator activated receptor gamma, PPAR-gamma [48524] (1 species)
  7. 448235Species Human (Homo sapiens) [TaxId:9606] [48525] (11 PDB entries)
  8. 448248Domain d1wm0x_: 1wm0 X: [109404]

Details for d1wm0x_

PDB Entry: 1wm0 (more details), 2.9 Å

PDB Description: PPARgamma in complex with a 2-BABA compound

SCOP Domain Sequences for d1wm0x_:

Sequence, based on SEQRES records: (download)

>d1wm0x_ a.123.1.1 (X:) Peroxisome proliferator activated receptor gamma, PPAR-gamma {Human (Homo sapiens)}
iegrlnpesadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmge
dkikfkhitplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllk
ygvheiiytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalel
ddsdlaifiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkm
tdlrqivtehvqllqvikktetdmslhpllqeiykdly

Sequence, based on observed residues (ATOM records): (download)

>d1wm0x_ a.123.1.1 (X:) Peroxisome proliferator activated receptor gamma, PPAR-gamma {Human (Homo sapiens)}
iegrlnpesadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmge
dkikfkhiskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvhei
iytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdla
ifiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqi
vtehvqllqvikktetdmslhpllqeiykdly

SCOP Domain Coordinates for d1wm0x_:

Click to download the PDB-style file with coordinates for d1wm0x_.
(The format of our PDB-style files is described here.)

Timeline for d1wm0x_: