Lineage for d1wm0x1 (1wm0 X:204-477)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2008476Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2008477Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2008478Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 protein domains)
  6. 2008960Protein Peroxisome proliferator activated receptor gamma, PPAR-gamma [48524] (1 species)
  7. 2008961Species Human (Homo sapiens) [TaxId:9606] [48525] (104 PDB entries)
    Uniprot P37231 232-505
  8. 2009121Domain d1wm0x1: 1wm0 X:204-477 [109404]
    Other proteins in same PDB: d1wm0x2
    complexed with plb

Details for d1wm0x1

PDB Entry: 1wm0 (more details), 2.9 Å

PDB Description: PPARgamma in complex with a 2-BABA compound
PDB Compounds: (X:) Peroxisome proliferator activated receptor gamma

SCOPe Domain Sequences for d1wm0x1:

Sequence, based on SEQRES records: (download)

>d1wm0x1 a.123.1.1 (X:204-477) Peroxisome proliferator activated receptor gamma, PPAR-gamma {Human (Homo sapiens) [TaxId: 9606]}
lnpesadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedkik
fkhitplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvh
eiiytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsd
laifiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlr
qivtehvqllqvikktetdmslhpllqeiykdly

Sequence, based on observed residues (ATOM records): (download)

>d1wm0x1 a.123.1.1 (X:204-477) Peroxisome proliferator activated receptor gamma, PPAR-gamma {Human (Homo sapiens) [TaxId: 9606]}
lnpesadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedkik
fkhiskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheiiytm
laslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlaifia
viilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqivteh
vqllqvikktetdmslhpllqeiykdly

SCOPe Domain Coordinates for d1wm0x1:

Click to download the PDB-style file with coordinates for d1wm0x1.
(The format of our PDB-style files is described here.)

Timeline for d1wm0x1: