Lineage for d1wlfa2 (1wlf A:13-99)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 502205Fold d.31: Cdc48 domain 2-like [54584] (1 superfamily)
    beta-alpha-beta(3); 2 layers: alpha/beta
  4. 502206Superfamily d.31.1: Cdc48 domain 2-like [54585] (1 family) (S)
  5. 502207Family d.31.1.1: Cdc48 domain 2-like [54586] (4 proteins)
  6. 502235Protein Peroxisome biogenesis factor 1 (PEX-1), domain 2 [110874] (1 species)
  7. 502236Species Mouse (Mus musculus) [TaxId:10090] [110875] (1 PDB entry)
  8. 502237Domain d1wlfa2: 1wlf A:13-99 [109397]
    Other proteins in same PDB: d1wlfa1

Details for d1wlfa2

PDB Entry: 1wlf (more details), 2.05 Å

PDB Description: structure of the n-terminal domain of pex1 aaa-atpase: characterization of a putative adaptor-binding domain

SCOP Domain Sequences for d1wlfa2:

Sequence, based on SEQRES records: (download)

>d1wlfa2 d.31.1.1 (A:13-99) Peroxisome biogenesis factor 1 (PEX-1), domain 2 {Mouse (Mus musculus)}
ggavvtvaftnardcflhlprrlvaqlhllqnqaievasdhqptylswvegrhfndqsen
vaeinrqvgqklglssgdqvflrpcsh

Sequence, based on observed residues (ATOM records): (download)

>d1wlfa2 d.31.1.1 (A:13-99) Peroxisome biogenesis factor 1 (PEX-1), domain 2 {Mouse (Mus musculus)}
ggavvtvaftnardcflhlprrlvaqlhllqnqaievasdhqptylswvegrhfnenvae
inrqvgqklglssgdqvflrpcsh

SCOP Domain Coordinates for d1wlfa2:

Click to download the PDB-style file with coordinates for d1wlfa2.
(The format of our PDB-style files is described here.)

Timeline for d1wlfa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1wlfa1