SCOPe 2.08: Domain d1wlfa2: 1wlf A:13-99

Lineage for d1wlfa2 (1wlf A:13-99)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.52: Double psi beta-barrel [50684] (2 superfamilies)
   barrel, closed; n=6, S=10; complex topology with crossover (psi) loops

4. Superfamily b.52.2: ADC-like [50692] (4 families)

5. Family b.52.2.3: Cdc48 N-terminal domain-like [50708] (4 proteins)

6. Protein Peroxisome biogenesis factor 1 (PEX-1), N-terminal domain [110252] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [110253] (1 PDB entry)
   Uniprot Q5BL07 13-179

8. Domain d1wlfa2: 1wlf A:13-99 [109397]
   Other proteins in same PDB: d1wlfa1
   complexed with so4

Details for d1wlfa2

PDB Entry: 1wlf, 2.05 Å

PDB Description: structure of the n-terminal domain of pex1 aaa-atpase: characterization of a putative adaptor-binding domain

PDB Compounds: (A:) Peroxisome biogenesis factor 1

SCOPe Domain Sequences for d1wlfa2:

Sequence, based on SEQRES records:

>d1wlfa2 b.52.2.3 (A:13-99) Peroxisome biogenesis factor 1 (PEX-1), N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]}
ggavvtvaftnardcflhlprrlvaqlhllqnqaievasdhqptylswvegrhfndqsen
vaeinrqvgqklglssgdqvflrpcsh

Sequence, based on observed residues (ATOM records):

>d1wlfa2 b.52.2.3 (A:13-99) Peroxisome biogenesis factor 1 (PEX-1), N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]}
ggavvtvaftnardcflhlprrlvaqlhllqnqaievasdhqptylswvegrhfnenvae
inrqvgqklglssgdqvflrpcsh

Timeline for d1wlfa2:

• d1wlfa2 first appeared in SCOP 1.69
  
• d1wlfa2 appears in SCOPe 2.07