Lineage for d1wlfa1 (1wlf A:100-179)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2186568Fold d.31: Cdc48 domain 2-like [54584] (1 superfamily)
    beta-alpha-beta(3); 2 layers: alpha/beta
  4. 2186569Superfamily d.31.1: Cdc48 domain 2-like [54585] (2 families) (S)
  5. 2186570Family d.31.1.1: Cdc48 domain 2-like [54586] (4 proteins)
  6. 2186624Protein Peroxisome biogenesis factor 1 (PEX-1), domain 2 [110874] (1 species)
  7. 2186625Species Mouse (Mus musculus) [TaxId:10090] [110875] (1 PDB entry)
    Uniprot Q5BL07 13-179
  8. 2186626Domain d1wlfa1: 1wlf A:100-179 [109396]
    Other proteins in same PDB: d1wlfa2
    complexed with so4

Details for d1wlfa1

PDB Entry: 1wlf (more details), 2.05 Å

PDB Description: structure of the n-terminal domain of pex1 aaa-atpase: characterization of a putative adaptor-binding domain
PDB Compounds: (A:) Peroxisome biogenesis factor 1

SCOPe Domain Sequences for d1wlfa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wlfa1 d.31.1.1 (A:100-179) Peroxisome biogenesis factor 1 (PEX-1), domain 2 {Mouse (Mus musculus) [TaxId: 10090]}
vvscqqveveplsaddweilelhaisleqhlldqirivfpkavvpiwvdqqtyifiqivt
lmpaapygrletntklliqp

SCOPe Domain Coordinates for d1wlfa1:

Click to download the PDB-style file with coordinates for d1wlfa1.
(The format of our PDB-style files is described here.)

Timeline for d1wlfa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1wlfa2