SCOP 1.69: Domain d1wlfa1: 1wlf A:100-179

Lineage for d1wlfa1 (1wlf A:100-179)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.52: Double psi beta-barrel [50684] (2 superfamilies)
   barrel, closed; n=6, S=10; complex topology with crossover (psi) loops

4. Superfamily b.52.2: ADC-like [50692] (3 families)

5. Family b.52.2.3: Cdc48 N-terminal domain-like [50708] (4 proteins)

6. Protein Peroxisome biogenesis factor 1 (PEX-1), N-terminal domain [110252] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [110253] (1 PDB entry)

8. Domain d1wlfa1: 1wlf A:100-179 [109396]
   Other proteins in same PDB: d1wlfa2

Details for d1wlfa1

PDB Entry: 1wlf, 2.05 Å

PDB Description: structure of the n-terminal domain of pex1 aaa-atpase: characterization of a putative adaptor-binding domain

SCOP Domain Sequences for d1wlfa1:

Sequence; same for both SEQRES and ATOM records:

>d1wlfa1 b.52.2.3 (A:100-179) Peroxisome biogenesis factor 1 (PEX-1), N-terminal domain {Mouse (Mus musculus)}
vvscqqveveplsaddweilelhaisleqhlldqirivfpkavvpiwvdqqtyifiqivt
lmpaapygrletntklliqp

Timeline for d1wlfa1:

• d1wlfa1 is new in SCOP 1.69
  
• d1wlfa1 appears in SCOP 1.71
  
• d1wlfa1 appears in the current release, SCOPe 2.08