SCOPe 2.08: Domain d1wlfa1: 1wlf A:100-179

Lineage for d1wlfa1 (1wlf A:100-179)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.31: Cdc48 domain 2-like [54584] (1 superfamily)
   beta-alpha-beta(3); 2 layers: alpha/beta

4. Superfamily d.31.1: Cdc48 domain 2-like [54585] (2 families)

5. Family d.31.1.1: Cdc48 domain 2-like [54586] (4 proteins)

6. Protein Peroxisome biogenesis factor 1 (PEX-1), domain 2 [110874] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [110875] (1 PDB entry)
   Uniprot Q5BL07 13-179

8. Domain d1wlfa1: 1wlf A:100-179 [109396]
   Other proteins in same PDB: d1wlfa2
   complexed with so4

Details for d1wlfa1

PDB Entry: 1wlf, 2.05 Å

PDB Description: structure of the n-terminal domain of pex1 aaa-atpase: characterization of a putative adaptor-binding domain

PDB Compounds: (A:) Peroxisome biogenesis factor 1

SCOPe Domain Sequences for d1wlfa1:

Sequence; same for both SEQRES and ATOM records:

>d1wlfa1 d.31.1.1 (A:100-179) Peroxisome biogenesis factor 1 (PEX-1), domain 2 {Mouse (Mus musculus) [TaxId: 10090]}
vvscqqveveplsaddweilelhaisleqhlldqirivfpkavvpiwvdqqtyifiqivt
lmpaapygrletntklliqp

Timeline for d1wlfa1:

• d1wlfa1 first appeared in SCOP 1.69
  
• d1wlfa1 appears in SCOPe 2.07