Lineage for d1wkra_ (1wkr A:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 955287Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 955288Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 956278Family b.50.1.2: Pepsin-like [50646] (11 proteins)
    duplication: consists of two similar barrel domains
    N-terminal: barrel, partly opened; n*=6, S*=10
  6. 956279Protein Acid protease [50649] (9 species)
  7. 956323Species Irpex lacteus (Polyporus tulipiferae), Polyporopepsin [TaxId:5319] [110246] (1 PDB entry)
    Uniprot P17576 1-329
  8. 956324Domain d1wkra_: 1wkr A: [109395]
    complexed with so4

Details for d1wkra_

PDB Entry: 1wkr (more details), 1.3 Å

PDB Description: Crystal structure of aspartic proteinase from Irpex lacteus
PDB Compounds: (A:) Polyporopepsin

SCOPe Domain Sequences for d1wkra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wkra_ b.50.1.2 (A:) Acid protease {Irpex lacteus (Polyporus tulipiferae), Polyporopepsin [TaxId: 5319]}
aagsvpatnqlvdyvvnvgvgspattysllvdtgssntwlgadksyvktstssatsdkvs
vtygsgsfsgteytdtvtlgsltipkqsigvasrdsgfdgvdgilgvgpvdltvgtlsph
tstsiptvtdnlfsqgtiptnllavsfepttsesstngeltfgatdsskytgsitytpit
stspasaywginqsirygsstsilsstagivdtgttltliasdafakykkatgavadnnt
gllrlttaqyanlqslfftiggqtfeltanaqiwprnlntaiggsassvylivgdlgsds
gegldfingltflerfysvydttnkrlglattsfttatsn

SCOPe Domain Coordinates for d1wkra_:

Click to download the PDB-style file with coordinates for d1wkra_.
(The format of our PDB-style files is described here.)

Timeline for d1wkra_: