Lineage for d1wkra_ (1wkr A:)
- Root: SCOP 1.69
Class b: All beta proteins [48724] (144 folds) 
Fold b.50: Acid proteases [50629] (1 superfamily)
barrel, closed; n=6, S=10, complex topologySuperfamily b.50.1: Acid proteases [50630] (2 families) 
Family b.50.1.2: Pepsin-like [50646] (10 proteins)
duplication: consists of two similar barrel domains
N-terminal: barrel, partly opened; n*=6, S*=10
Protein Acid protease [50649] (9 species) 
Species Irpex lacteus (Polyporus tulipiferae), Polyporopepsin [TaxId:5319] [110246] (1 PDB entry) 
Domain d1wkra_: 1wkr A: [109395]
Details for d1wkra_
PDB Entry: 1wkr (more details), 1.3 Å
PDB Description: Crystal structure of aspartic proteinase from Irpex lacteus
SCOP Domain Sequences for d1wkra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wkra_ b.50.1.2 (A:) Acid protease {Irpex lacteus (Polyporus tulipiferae), Polyporopepsin}
aagsvpatnqlvdyvvnvgvgspattysllvdtgssntwlgadksyvktstssatsdkvs
vtygsgsfsgteytdtvtlgsltipkqsigvasrdsgfdgvdgilgvgpvdltvgtlsph
tstsiptvtdnlfsqgtiptnllavsfepttsesstngeltfgatdsskytgsitytpit
stspasaywginqsirygsstsilsstagivdtgttltliasdafakykkatgavadnnt
gllrlttaqyanlqslfftiggqtfeltanaqiwprnlntaiggsassvylivgdlgsds
gegldfingltflerfysvydttnkrlglattsfttatsn
SCOP Domain Coordinates for d1wkra_:
Click to download the PDB-style file with coordinates for d1wkra_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1wkra_:
- d1wkra_ is new in SCOP 1.69
- d1wkra_ appears in SCOP 1.71
- d1wkra_ appears in the current release, SCOPe 2.08
View in 3D