Class b: All beta proteins [48724] (180 folds) |
Fold b.50: Acid proteases [50629] (1 superfamily) barrel, closed; n=6, S=10, complex topology |
Superfamily b.50.1: Acid proteases [50630] (4 families) |
Family b.50.1.2: Pepsin-like [50646] (11 proteins) duplication: consists of two similar barrel domains N-terminal: barrel, partly opened; n*=6, S*=10 |
Protein Acid protease [50649] (9 species) |
Species Irpex lacteus (Polyporus tulipiferae), Polyporopepsin [TaxId:5319] [110246] (1 PDB entry) Uniprot P17576 1-329 |
Domain d1wkra_: 1wkr A: [109395] complexed with so4 |
PDB Entry: 1wkr (more details), 1.3 Å
SCOPe Domain Sequences for d1wkra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wkra_ b.50.1.2 (A:) Acid protease {Irpex lacteus (Polyporus tulipiferae), Polyporopepsin [TaxId: 5319]} aagsvpatnqlvdyvvnvgvgspattysllvdtgssntwlgadksyvktstssatsdkvs vtygsgsfsgteytdtvtlgsltipkqsigvasrdsgfdgvdgilgvgpvdltvgtlsph tstsiptvtdnlfsqgtiptnllavsfepttsesstngeltfgatdsskytgsitytpit stspasaywginqsirygsstsilsstagivdtgttltliasdafakykkatgavadnnt gllrlttaqyanlqslfftiggqtfeltanaqiwprnlntaiggsassvylivgdlgsds gegldfingltflerfysvydttnkrlglattsfttatsn
Timeline for d1wkra_: