SCOP 1.69: Domain d1wkqb_: 1wkq B:

Lineage for d1wkqb_ (1wkq B:)

1. Root: SCOP 1.69

2. Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

3. Fold c.97: Cytidine deaminase-like [53926] (3 superfamilies)
   core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 2 is antiparallel to the rest

4. Superfamily c.97.1: Cytidine deaminase-like [53927] (2 families)

5. Family c.97.1.2: Deoxycytidylate deaminase-like [89800] (2 proteins)

6. Protein Guanine deaminase GuaD [110765] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [110766] (2 PDB entries)

8. Domain d1wkqb_: 1wkq B: [109394]

Details for d1wkqb_

PDB Entry: 1wkq, 1.17 Å

PDB Description: Crystal Structure of Bacillus subtilis Guanine Deaminase. The first domain-swapped structure in the cytidine deaminase superfamily

SCOP Domain Sequences for d1wkqb_:

Sequence; same for both SEQRES and ATOM records:

>d1wkqb_ c.97.1.2 (B:) Guanine deaminase GuaD {Bacillus subtilis}
nhetflkravtlacegvnagiggpfgavivkdgaiiaegqnnvttsndptahaevtairk
ackvlgayqlddcilytscepcpmclgaiywarpkavfyaaehtdaaeagfddsfiykei
dkpaeertipfyqvtltehlspfqawrnfankkey

Timeline for d1wkqb_:

• d1wkqb_ is new in SCOP 1.69
  
• d1wkqb_ appears in SCOP 1.71
  
• d1wkqb_ appears in the current release, SCOPe 2.08