Lineage for d1wkqb_ (1wkq B:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 495641Fold c.97: Cytidine deaminase-like [53926] (3 superfamilies)
    core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 2 is antiparallel to the rest
  4. 495642Superfamily c.97.1: Cytidine deaminase-like [53927] (2 families) (S)
  5. 495674Family c.97.1.2: Deoxycytidylate deaminase-like [89800] (2 proteins)
  6. 495685Protein Guanine deaminase GuaD [110765] (1 species)
  7. 495686Species Bacillus subtilis [TaxId:1423] [110766] (2 PDB entries)
  8. 495688Domain d1wkqb_: 1wkq B: [109394]

Details for d1wkqb_

PDB Entry: 1wkq (more details), 1.17 Å

PDB Description: Crystal Structure of Bacillus subtilis Guanine Deaminase. The first domain-swapped structure in the cytidine deaminase superfamily

SCOP Domain Sequences for d1wkqb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wkqb_ c.97.1.2 (B:) Guanine deaminase GuaD {Bacillus subtilis}
nhetflkravtlacegvnagiggpfgavivkdgaiiaegqnnvttsndptahaevtairk
ackvlgayqlddcilytscepcpmclgaiywarpkavfyaaehtdaaeagfddsfiykei
dkpaeertipfyqvtltehlspfqawrnfankkey

SCOP Domain Coordinates for d1wkqb_:

Click to download the PDB-style file with coordinates for d1wkqb_.
(The format of our PDB-style files is described here.)

Timeline for d1wkqb_: