Lineage for d1wkqb_ (1wkq B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2918481Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies)
    core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest
  4. 2918482Superfamily c.97.1: Cytidine deaminase-like [53927] (7 families) (S)
    contains extra C-terminal strand 5, order 21345
  5. 2918566Family c.97.1.2: Deoxycytidylate deaminase-like [89800] (8 proteins)
    strand 5 is parallel to strand 4
  6. 2918591Protein Guanine deaminase GuaD [110765] (1 species)
  7. 2918592Species Bacillus subtilis [TaxId:1423] [110766] (2 PDB entries)
    Uniprot O34598
  8. 2918594Domain d1wkqb_: 1wkq B: [109394]
    Other proteins in same PDB: d1wkqa2
    complexed with imd, zn

Details for d1wkqb_

PDB Entry: 1wkq (more details), 1.17 Å

PDB Description: Crystal Structure of Bacillus subtilis Guanine Deaminase. The first domain-swapped structure in the cytidine deaminase superfamily
PDB Compounds: (B:) guanine deaminase

SCOPe Domain Sequences for d1wkqb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wkqb_ c.97.1.2 (B:) Guanine deaminase GuaD {Bacillus subtilis [TaxId: 1423]}
nhetflkravtlacegvnagiggpfgavivkdgaiiaegqnnvttsndptahaevtairk
ackvlgayqlddcilytscepcpmclgaiywarpkavfyaaehtdaaeagfddsfiykei
dkpaeertipfyqvtltehlspfqawrnfankkey

SCOPe Domain Coordinates for d1wkqb_:

Click to download the PDB-style file with coordinates for d1wkqb_.
(The format of our PDB-style files is described here.)

Timeline for d1wkqb_: