Lineage for d1wf4r_ (1wf4 r:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 666133Fold b.35: GroES-like [50128] (2 superfamilies)
    contains barrel, partly opened; n*=4, S*=8; meander
  4. 666134Superfamily b.35.1: GroES-like [50129] (2 families) (S)
  5. 666135Family b.35.1.1: GroES [50130] (2 proteins)
  6. 666136Protein Chaperonin-10 (GroES) [50131] (4 species)
  7. 666217Species Thermus thermophilus [TaxId:274] [110172] (3 PDB entries)
  8. 666228Domain d1wf4r_: 1wf4 r: [109385]
    Other proteins in same PDB: d1wf4a1, d1wf4a2, d1wf4a3, d1wf4b1, d1wf4b2, d1wf4b3, d1wf4c1, d1wf4c2, d1wf4c3, d1wf4d1, d1wf4d2, d1wf4d3, d1wf4e1, d1wf4e2, d1wf4e3, d1wf4f1, d1wf4f2, d1wf4f3, d1wf4g1, d1wf4g2, d1wf4g3, d1wf4h1, d1wf4h2, d1wf4h3, d1wf4i1, d1wf4i2, d1wf4i3, d1wf4j1, d1wf4j2, d1wf4j3, d1wf4k1, d1wf4k2, d1wf4k3, d1wf4l1, d1wf4l2, d1wf4l3, d1wf4m1, d1wf4m2, d1wf4m3, d1wf4n1, d1wf4n2, d1wf4n3

Details for d1wf4r_

PDB Entry: 1wf4 (more details), 2.8 Å

PDB Description: Crystal Structure of the Chaperonin Complex Cpn60/Cpn10/(ADP)7 from Thermus Thermophilus
PDB Compounds: (r:) cpn10(GroES)

SCOP Domain Sequences for d1wf4r_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wf4r_ b.35.1.1 (r:) Chaperonin-10 (GroES) {Thermus thermophilus [TaxId: 274]}
ktvikplgdrvvvkrieeepktkggivlpdtakekpqkgkviavgtgrvlengqrvplev
kegdivvfakyggteieidgeeyvilserdllavlq

SCOP Domain Coordinates for d1wf4r_:

Click to download the PDB-style file with coordinates for d1wf4r_.
(The format of our PDB-style files is described here.)

Timeline for d1wf4r_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1wf4a1, d1wf4a2, d1wf4a3, d1wf4b1, d1wf4b2, d1wf4b3, d1wf4c1, d1wf4c2, d1wf4c3, d1wf4d1, d1wf4d2, d1wf4d3, d1wf4e1, d1wf4e2, d1wf4e3, d1wf4f1, d1wf4f2, d1wf4f3, d1wf4g1, d1wf4g2, d1wf4g3, d1wf4h1, d1wf4h2, d1wf4h3, d1wf4i1, d1wf4i2, d1wf4i3, d1wf4j1, d1wf4j2, d1wf4j3, d1wf4k1, d1wf4k2, d1wf4k3, d1wf4l1, d1wf4l2, d1wf4l3, d1wf4m1, d1wf4m2, d1wf4m3, d1wf4n1, d1wf4n2, d1wf4n3, d1wf4o_, d1wf4p_, d1wf4q_, d1wf4s_, d1wf4t_, d1wf4u_