SCOPe 2.07: Domain d1wf4l2: 1wf4 l:190-373

Lineage for d1wf4l2 (1wf4 l:190-373)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (10 superfamilies)
   3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
   this domain is thought to be mobile in most multi-domain proteins known to contain it

4. Superfamily c.8.5: GroEL apical domain-like [52029] (3 families)

5. Family c.8.5.1: GroEL-like chaperone, apical domain [52030] (2 proteins)

6. Protein GroEL, A domain [52031] (4 species)

7. Species Thermus thermophilus [TaxId:274] [52033] (3 PDB entries)
   Uniprot P61491

8. Domain d1wf4l2: 1wf4 l:190-373 [109374]
   Other proteins in same PDB: d1wf4a1, d1wf4a3, d1wf4b1, d1wf4b3, d1wf4c1, d1wf4c3, d1wf4d1, d1wf4d3, d1wf4e1, d1wf4e3, d1wf4f1, d1wf4f3, d1wf4g1, d1wf4g3, d1wf4h1, d1wf4h3, d1wf4i1, d1wf4i3, d1wf4j1, d1wf4j3, d1wf4k1, d1wf4k3, d1wf4l1, d1wf4l3, d1wf4m1, d1wf4m3, d1wf4n1, d1wf4n3, d1wf4o_, d1wf4p_, d1wf4q_, d1wf4r_, d1wf4s_, d1wf4t_, d1wf4u_
   complexed with adp, dms, mg
   complexed with adp, dms, mg

Details for d1wf4l2

PDB Entry: 1wf4, 2.8 Å

PDB Description: Crystal Structure of the Chaperonin Complex Cpn60/Cpn10/(ADP)7 from Thermus Thermophilus

PDB Compounds: (l:) cpn60(GroEL)

SCOPe Domain Sequences for d1wf4l2:

Sequence; same for both SEQRES and ATOM records:

>d1wf4l2 c.8.5.1 (l:190-373) GroEL, A domain {Thermus thermophilus [TaxId: 274]}
egyqfdkgyispyfvtnpetmeavledafilivekkvsnvrellpileqvaqtgkpllii
aedvegealatlvvnklrgtlsvaavkapgfgdrrkemlkdiaavtggtviseelgfkle
natlsmlgraervritkdettivggkgkkediearingikkelettdseyareklqerla
klag

Timeline for d1wf4l2:

• d1wf4l2 first appeared in SCOP 1.69
  
• d1wf4l2 appears in SCOPe 2.06
  
• d1wf4l2 appears in the current release, SCOPe 2.08