Lineage for d1wf4j3 (1wf4 j:139-189,j:374-408)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1413468Fold d.56: GroEL-intermediate domain like [54848] (1 superfamily)
    3-helical bundle packed against 3-stranded mixed beta-sheet
  4. 1413469Superfamily d.56.1: GroEL-intermediate domain like [54849] (2 families) (S)
  5. 1413470Family d.56.1.1: GroEL-like chaperone, intermediate domain [54850] (1 protein)
  6. 1413471Protein GroEL, I domain [54851] (4 species)
  7. 1413624Species Thermus thermophilus [TaxId:274] [110940] (2 PDB entries)
    Uniprot P61491
  8. 1413648Domain d1wf4j3: 1wf4 j:139-189,j:374-408 [109369]
    Other proteins in same PDB: d1wf4a1, d1wf4a2, d1wf4b1, d1wf4b2, d1wf4c1, d1wf4c2, d1wf4d1, d1wf4d2, d1wf4e1, d1wf4e2, d1wf4f1, d1wf4f2, d1wf4g1, d1wf4g2, d1wf4h1, d1wf4h2, d1wf4i1, d1wf4i2, d1wf4j1, d1wf4j2, d1wf4k1, d1wf4k2, d1wf4l1, d1wf4l2, d1wf4m1, d1wf4m2, d1wf4n1, d1wf4n2, d1wf4o_, d1wf4p_, d1wf4q_, d1wf4r_, d1wf4s_, d1wf4t_, d1wf4u_
    complexed with adp, dms, mg

Details for d1wf4j3

PDB Entry: 1wf4 (more details), 2.8 Å

PDB Description: Crystal Structure of the Chaperonin Complex Cpn60/Cpn10/(ADP)7 from Thermus Thermophilus
PDB Compounds: (j:) cpn60(GroEL)

SCOPe Domain Sequences for d1wf4j3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wf4j3 d.56.1.1 (j:139-189,j:374-408) GroEL, I domain {Thermus thermophilus [TaxId: 274]}
edrkaieevatisandpevgkliadamekvgkegiitveesksletelkfvXgvavirvg
aatetelkekkhrfedalnatraavee

SCOPe Domain Coordinates for d1wf4j3:

Click to download the PDB-style file with coordinates for d1wf4j3.
(The format of our PDB-style files is described here.)

Timeline for d1wf4j3:

View in 3D
Domains from other chains:
(mouse over for more information)
d1wf4a1, d1wf4a2, d1wf4a3, d1wf4b1, d1wf4b2, d1wf4b3, d1wf4c1, d1wf4c2, d1wf4c3, d1wf4d1, d1wf4d2, d1wf4d3, d1wf4e1, d1wf4e2, d1wf4e3, d1wf4f1, d1wf4f2, d1wf4f3, d1wf4g1, d1wf4g2, d1wf4g3, d1wf4h1, d1wf4h2, d1wf4h3, d1wf4i1, d1wf4i2, d1wf4i3, d1wf4k1, d1wf4k2, d1wf4k3, d1wf4l1, d1wf4l2, d1wf4l3, d1wf4m1, d1wf4m2, d1wf4m3, d1wf4n1, d1wf4n2, d1wf4n3, d1wf4o_, d1wf4p_, d1wf4q_, d1wf4r_, d1wf4s_, d1wf4t_, d1wf4u_