Lineage for d1weia_ (1wei A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2003278Fold a.96: DNA-glycosylase [48149] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2003279Superfamily a.96.1: DNA-glycosylase [48150] (7 families) (S)
  5. 2003287Family a.96.1.2: Mismatch glycosylase [48154] (4 protein domains)
  6. 2003288Protein Catalytic domain of MutY [48155] (2 species)
  7. 2003295Species Escherichia coli [TaxId:562] [48156] (13 PDB entries)
    Uniprot P17802 1-225
  8. 2003303Domain d1weia_: 1wei A: [109339]
    complexed with ade, edo, sf4; mutant

Details for d1weia_

PDB Entry: 1wei (more details), 1.45 Å

PDB Description: Catalytic Domain Of Muty From Escherichia Coli K20A Mutant Complexed To Adenine
PDB Compounds: (A:) A/G-specific adenine glycosylase

SCOPe Domain Sequences for d1weia_:

Sequence, based on SEQRES records: (download)

>d1weia_ a.96.1.2 (A:) Catalytic domain of MutY {Escherichia coli [TaxId: 562]}
mqasqfsaqvldwydkygratlpwqidktpykvwlsevmlqqtqvatvipyferfmarfp
tvtdlanapldevlhlwtglgyyararnlhkaaqqvatlhggkfpetfeevaalpgvgrs
tagailslslgkhfpildgnvkrvlarcyavsgwpgkkevenklwslseqvtpavgverf
nqammdlgamictrskpkcslcplqngciaaannswalypgkkp

Sequence, based on observed residues (ATOM records): (download)

>d1weia_ a.96.1.2 (A:) Catalytic domain of MutY {Escherichia coli [TaxId: 562]}
mqasqfsaqvldwydkygratlpwqidktpykvwlsevmlqqtqvatvipyferfmarfp
tvtdlanapldevlhlwtglgyyararnlhkaaqqvatlhggkfpetfeevaalpgvgrs
tagailslslgkhfpildgnvkrvlaryavsgwpgkkevenklwlseqvtpavgverfnq
ammdlgamctrskpkclcplqngciaaannswalypgkkp

SCOPe Domain Coordinates for d1weia_:

Click to download the PDB-style file with coordinates for d1weia_.
(The format of our PDB-style files is described here.)

Timeline for d1weia_: