Lineage for d1wega_ (1weg A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2003278Fold a.96: DNA-glycosylase [48149] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2003279Superfamily a.96.1: DNA-glycosylase [48150] (7 families) (S)
  5. 2003287Family a.96.1.2: Mismatch glycosylase [48154] (4 protein domains)
  6. 2003288Protein Catalytic domain of MutY [48155] (2 species)
  7. 2003295Species Escherichia coli [TaxId:562] [48156] (13 PDB entries)
    Uniprot P17802 1-225
  8. 2003308Domain d1wega_: 1weg A: [109338]
    complexed with edo, imd, sf4; mutant

Details for d1wega_

PDB Entry: 1weg (more details), 1.8 Å

PDB Description: Catalytic Domain Of Muty From Escherichia Coli K142A Mutant
PDB Compounds: (A:) A/G-specific adenine glycosylase

SCOPe Domain Sequences for d1wega_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wega_ a.96.1.2 (A:) Catalytic domain of MutY {Escherichia coli [TaxId: 562]}
mqasqfsaqvldwydkygrktlpwqidktpykvwlsevmlqqtqvatvipyferfmarfp
tvtdlanapldevlhlwtglgyyararnlhkaaqqvatlhggkfpetfeevaalpgvgrs
tagailslslgkhfpildgnvarvlarcyavsgwpgkkevenklwslseqvtpavgverf
nqammdlgamictrskpkcslcplqngciaaannswalypgkkpk

SCOPe Domain Coordinates for d1wega_:

Click to download the PDB-style file with coordinates for d1wega_.
(The format of our PDB-style files is described here.)

Timeline for d1wega_: