SCOPe 2.08: Domain d1wefa_: 1wef A:

Lineage for d1wefa_ (1wef A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.96: DNA-glycosylase [48149] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.96.1: DNA-glycosylase [48150] (7 families)

5. Family a.96.1.2: Mismatch glycosylase [48154] (4 proteins)

6. Protein Catalytic domain of MutY [48155] (2 species)

7. Species Escherichia coli [TaxId:562] [48156] (13 PDB entries)
   Uniprot P17802 1-225

8. Domain d1wefa_: 1wef A: [109337]
   complexed with sf4; mutant

Details for d1wefa_

PDB Entry: 1wef, 1.9 Å

PDB Description: catalytic domain of muty from escherichia coli k20a mutant

PDB Compounds: (A:) A/G-specific adenine glycosylase

SCOPe Domain Sequences for d1wefa_:

Sequence; same for both SEQRES and ATOM records:

>d1wefa_ a.96.1.2 (A:) Catalytic domain of MutY {Escherichia coli [TaxId: 562]}
mqasqfsaqvldwydkygratlpwqidktpykvwlsevmlqqtqvatvipyferfmarfp
tvtdlanapldevlhlwtglgyyararnlhkaaqqvatlhggkfpetfeevaalpgvgrs
tagailslslgkhfpildgnvkrvlarcyavsgwpgkkevenklwslseqvtpavgverf
nqammdlgamictrskpkcslcplqngciaaannswalypgkkpk

Timeline for d1wefa_:

• d1wefa_ first appeared in SCOP 1.69
  
• d1wefa_ appears in SCOPe 2.07