Lineage for d1we3u_ (1we3 U:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1311670Fold b.35: GroES-like [50128] (2 superfamilies)
    contains barrel, partly opened; n*=4, S*=8; meander
  4. 1311671Superfamily b.35.1: GroES-like [50129] (3 families) (S)
  5. 1311672Family b.35.1.1: GroES [50130] (2 proteins)
    automatically mapped to Pfam PF00166
  6. 1311673Protein Chaperonin-10 (GroES) [50131] (4 species)
  7. 1311754Species Thermus thermophilus [TaxId:274] [110172] (3 PDB entries)
    Uniprot P61493 ! Uniprot P61492
  8. 1311761Domain d1we3u_: 1we3 U: [109336]
    Other proteins in same PDB: d1we3a1, d1we3a2, d1we3a3, d1we3b1, d1we3b2, d1we3b3, d1we3c1, d1we3c2, d1we3c3, d1we3d1, d1we3d2, d1we3d3, d1we3e1, d1we3e2, d1we3e3, d1we3f1, d1we3f2, d1we3f3, d1we3g1, d1we3g2, d1we3g3, d1we3h1, d1we3h2, d1we3h3, d1we3i1, d1we3i2, d1we3i3, d1we3j1, d1we3j2, d1we3j3, d1we3k1, d1we3k2, d1we3k3, d1we3l1, d1we3l2, d1we3l3, d1we3m1, d1we3m2, d1we3m3, d1we3n1, d1we3n2, d1we3n3
    complexed with adp, dms, mg

Details for d1we3u_

PDB Entry: 1we3 (more details), 2.8 Å

PDB Description: Crystal Structure of the Chaperonin Complex Cpn60/Cpn10/(ADP)7 from Thermus Thermophilus
PDB Compounds: (U:) cpn10(GroES)

SCOPe Domain Sequences for d1we3u_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1we3u_ b.35.1.1 (U:) Chaperonin-10 (GroES) {Thermus thermophilus [TaxId: 274]}
ktvikplgdrvvvkrieeepktkggivlpdtakekpqkgkviavgtgrvlengqrvplev
kegdivvfakyggteieidgeeyvilserdllavlq

SCOPe Domain Coordinates for d1we3u_:

Click to download the PDB-style file with coordinates for d1we3u_.
(The format of our PDB-style files is described here.)

Timeline for d1we3u_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1we3a1, d1we3a2, d1we3a3, d1we3b1, d1we3b2, d1we3b3, d1we3c1, d1we3c2, d1we3c3, d1we3d1, d1we3d2, d1we3d3, d1we3e1, d1we3e2, d1we3e3, d1we3f1, d1we3f2, d1we3f3, d1we3g1, d1we3g2, d1we3g3, d1we3h1, d1we3h2, d1we3h3, d1we3i1, d1we3i2, d1we3i3, d1we3j1, d1we3j2, d1we3j3, d1we3k1, d1we3k2, d1we3k3, d1we3l1, d1we3l2, d1we3l3, d1we3m1, d1we3m2, d1we3m3, d1we3n1, d1we3n2, d1we3n3, d1we3o_, d1we3p_, d1we3q_, d1we3r_, d1we3s_, d1we3t_