Lineage for d1we3q_ (1we3 Q:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1538001Fold b.35: GroES-like [50128] (2 superfamilies)
    contains barrel, partly opened; n*=4, S*=8; meander
  4. 1538002Superfamily b.35.1: GroES-like [50129] (3 families) (S)
  5. 1538003Family b.35.1.1: GroES [50130] (2 proteins)
    automatically mapped to Pfam PF00166
  6. 1538004Protein Chaperonin-10 (GroES) [50131] (4 species)
  7. 1538085Species Thermus thermophilus [TaxId:274] [110172] (3 PDB entries)
    Uniprot P61493 ! Uniprot P61492
  8. 1538088Domain d1we3q_: 1we3 Q: [109332]
    Other proteins in same PDB: d1we3a1, d1we3a2, d1we3a3, d1we3b1, d1we3b2, d1we3b3, d1we3c1, d1we3c2, d1we3c3, d1we3d1, d1we3d2, d1we3d3, d1we3e1, d1we3e2, d1we3e3, d1we3f1, d1we3f2, d1we3f3, d1we3g1, d1we3g2, d1we3g3, d1we3h1, d1we3h2, d1we3h3, d1we3i1, d1we3i2, d1we3i3, d1we3j1, d1we3j2, d1we3j3, d1we3k1, d1we3k2, d1we3k3, d1we3l1, d1we3l2, d1we3l3, d1we3m1, d1we3m2, d1we3m3, d1we3n1, d1we3n2, d1we3n3
    complexed with adp, dms, mg

Details for d1we3q_

PDB Entry: 1we3 (more details), 2.8 Å

PDB Description: Crystal Structure of the Chaperonin Complex Cpn60/Cpn10/(ADP)7 from Thermus Thermophilus
PDB Compounds: (Q:) cpn10(GroES)

SCOPe Domain Sequences for d1we3q_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1we3q_ b.35.1.1 (Q:) Chaperonin-10 (GroES) {Thermus thermophilus [TaxId: 274]}
ktvikplgdrvvvkrieeepktkggivlpdtakekpqkgkviavgtgrvlengqrvplev
kegdivvfakyggteieidgeeyvilserdllavlq

SCOPe Domain Coordinates for d1we3q_:

Click to download the PDB-style file with coordinates for d1we3q_.
(The format of our PDB-style files is described here.)

Timeline for d1we3q_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1we3a1, d1we3a2, d1we3a3, d1we3b1, d1we3b2, d1we3b3, d1we3c1, d1we3c2, d1we3c3, d1we3d1, d1we3d2, d1we3d3, d1we3e1, d1we3e2, d1we3e3, d1we3f1, d1we3f2, d1we3f3, d1we3g1, d1we3g2, d1we3g3, d1we3h1, d1we3h2, d1we3h3, d1we3i1, d1we3i2, d1we3i3, d1we3j1, d1we3j2, d1we3j3, d1we3k1, d1we3k2, d1we3k3, d1we3l1, d1we3l2, d1we3l3, d1we3m1, d1we3m2, d1we3m3, d1we3n1, d1we3n2, d1we3n3, d1we3o_, d1we3p_, d1we3r_, d1we3s_, d1we3t_, d1we3u_