Lineage for d1we3l2 (1we3 L:190-373)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 979734Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (10 superfamilies)
    3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
    this domain is thought to be mobile in most multi-domain proteins known to contain it
  4. 979893Superfamily c.8.5: GroEL apical domain-like [52029] (2 families) (S)
  5. 979894Family c.8.5.1: GroEL-like chaperone, apical domain [52030] (2 proteins)
  6. 979895Protein GroEL, A domain [52031] (4 species)
  7. 980031Species Thermus thermophilus [TaxId:274] [52033] (3 PDB entries)
    Uniprot P61491
  8. 980044Domain d1we3l2: 1we3 L:190-373 [109322]
    Other proteins in same PDB: d1we3a1, d1we3a3, d1we3b1, d1we3b3, d1we3c1, d1we3c3, d1we3d1, d1we3d3, d1we3e1, d1we3e3, d1we3f1, d1we3f3, d1we3g1, d1we3g3, d1we3h1, d1we3h3, d1we3i1, d1we3i3, d1we3j1, d1we3j3, d1we3k1, d1we3k3, d1we3l1, d1we3l3, d1we3m1, d1we3m3, d1we3n1, d1we3n3, d1we3o_, d1we3p_, d1we3q_, d1we3r_, d1we3s_, d1we3t_, d1we3u_
    complexed with adp, dms, mg

Details for d1we3l2

PDB Entry: 1we3 (more details), 2.8 Å

PDB Description: Crystal Structure of the Chaperonin Complex Cpn60/Cpn10/(ADP)7 from Thermus Thermophilus
PDB Compounds: (L:) cpn60(GroEL)

SCOPe Domain Sequences for d1we3l2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1we3l2 c.8.5.1 (L:190-373) GroEL, A domain {Thermus thermophilus [TaxId: 274]}
egyqfdkgyispyfvtnpetmeavledafilivekkvsnvrellpileqvaqtgkpllii
aedvegealatlvvnklrgtlsvaavkapgfgdrrkemlkdiaavtggtviseelgfkle
natlsmlgraervritkdettivggkgkkediearingikkelettdseyareklqerla
klag

SCOPe Domain Coordinates for d1we3l2:

Click to download the PDB-style file with coordinates for d1we3l2.
(The format of our PDB-style files is described here.)

Timeline for d1we3l2:

View in 3D
Domains from other chains:
(mouse over for more information)
d1we3a1, d1we3a2, d1we3a3, d1we3b1, d1we3b2, d1we3b3, d1we3c1, d1we3c2, d1we3c3, d1we3d1, d1we3d2, d1we3d3, d1we3e1, d1we3e2, d1we3e3, d1we3f1, d1we3f2, d1we3f3, d1we3g1, d1we3g2, d1we3g3, d1we3h1, d1we3h2, d1we3h3, d1we3i1, d1we3i2, d1we3i3, d1we3j1, d1we3j2, d1we3j3, d1we3k1, d1we3k2, d1we3k3, d1we3m1, d1we3m2, d1we3m3, d1we3n1, d1we3n2, d1we3n3, d1we3o_, d1we3p_, d1we3q_, d1we3r_, d1we3s_, d1we3t_, d1we3u_