Lineage for d1we3f1 (1we3 F:3-138,F:409-527)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 448721Fold a.129: GroEL equatorial domain-like [48591] (1 superfamily)
    multihelical; 8 helices arranged in 2 parallel layers
  4. 448722Superfamily a.129.1: GroEL equatorial domain-like [48592] (2 families) (S)
    duplication: two 4-helical subdomains are related by a pseudo dyad passing through the ATP-binding site
  5. 448723Family a.129.1.1: GroEL chaperone, ATPase domain [48593] (1 protein)
  6. 448724Protein GroEL, E domain [48594] (3 species)
  7. 448840Species Thermus thermophilus [TaxId:274] [110024] (2 PDB entries)
  8. 448846Domain d1we3f1: 1we3 F:3-138,F:409-527 [109303]
    Other proteins in same PDB: d1we3a2, d1we3a3, d1we3b2, d1we3b3, d1we3c2, d1we3c3, d1we3d2, d1we3d3, d1we3e2, d1we3e3, d1we3f2, d1we3f3, d1we3g2, d1we3g3, d1we3h2, d1we3h3, d1we3i2, d1we3i3, d1we3j2, d1we3j3, d1we3k2, d1we3k3, d1we3l2, d1we3l3, d1we3m2, d1we3m3, d1we3n2, d1we3n3, d1we3o_, d1we3p_, d1we3q_, d1we3r_, d1we3s_, d1we3t_, d1we3u_

Details for d1we3f1

PDB Entry: 1we3 (more details), 2.8 Å

PDB Description: Crystal Structure of the Chaperonin Complex Cpn60/Cpn10/(ADP)7 from Thermus Thermophilus

SCOP Domain Sequences for d1we3f1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1we3f1 a.129.1.1 (F:3-138,F:409-527) GroEL, E domain {Thermus thermophilus}
akilvfdeaarralergvnavanavkvtlgprgrnvvlekkfgsptitkdgvtvakevel
edhlenigaqllkevasktndvagdgtttatvlaqaivreglknvaaganplalkrgiek
aveaavekikalaipvXgivpgggvtllraisaveelikklegdeatgakivrraleepa
rqiaenagyegsvivqqilaetknprygfnaatgefvdmveagivdpakvtrsalqnaas
igaliltteavvaekp

SCOP Domain Coordinates for d1we3f1:

Click to download the PDB-style file with coordinates for d1we3f1.
(The format of our PDB-style files is described here.)

Timeline for d1we3f1:

View in 3D
Domains from other chains:
(mouse over for more information)
d1we3a1, d1we3a2, d1we3a3, d1we3b1, d1we3b2, d1we3b3, d1we3c1, d1we3c2, d1we3c3, d1we3d1, d1we3d2, d1we3d3, d1we3e1, d1we3e2, d1we3e3, d1we3g1, d1we3g2, d1we3g3, d1we3h1, d1we3h2, d1we3h3, d1we3i1, d1we3i2, d1we3i3, d1we3j1, d1we3j2, d1we3j3, d1we3k1, d1we3k2, d1we3k3, d1we3l1, d1we3l2, d1we3l3, d1we3m1, d1we3m2, d1we3m3, d1we3n1, d1we3n2, d1we3n3, d1we3o_, d1we3p_, d1we3q_, d1we3r_, d1we3s_, d1we3t_, d1we3u_