Lineage for d1we3e3 (1we3 E:139-189,E:374-408)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1026296Fold d.56: GroEL-intermediate domain like [54848] (1 superfamily)
    3-helical bundle packed against 3-stranded mixed beta-sheet
  4. 1026297Superfamily d.56.1: GroEL-intermediate domain like [54849] (2 families) (S)
  5. 1026298Family d.56.1.1: GroEL-like chaperone, intermediate domain [54850] (1 protein)
  6. 1026299Protein GroEL, I domain [54851] (4 species)
  7. 1026424Species Thermus thermophilus [TaxId:274] [110940] (2 PDB entries)
    Uniprot P61491
  8. 1026429Domain d1we3e3: 1we3 E:139-189,E:374-408 [109302]
    Other proteins in same PDB: d1we3a1, d1we3a2, d1we3b1, d1we3b2, d1we3c1, d1we3c2, d1we3d1, d1we3d2, d1we3e1, d1we3e2, d1we3f1, d1we3f2, d1we3g1, d1we3g2, d1we3h1, d1we3h2, d1we3i1, d1we3i2, d1we3j1, d1we3j2, d1we3k1, d1we3k2, d1we3l1, d1we3l2, d1we3m1, d1we3m2, d1we3n1, d1we3n2, d1we3o_, d1we3p_, d1we3q_, d1we3r_, d1we3s_, d1we3t_, d1we3u_
    complexed with adp, dms, mg

Details for d1we3e3

PDB Entry: 1we3 (more details), 2.8 Å

PDB Description: Crystal Structure of the Chaperonin Complex Cpn60/Cpn10/(ADP)7 from Thermus Thermophilus
PDB Compounds: (E:) cpn60(GroEL)

SCOPe Domain Sequences for d1we3e3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1we3e3 d.56.1.1 (E:139-189,E:374-408) GroEL, I domain {Thermus thermophilus [TaxId: 274]}
edrkaieevatisandpevgkliadamekvgkegiitveesksletelkfvXgvavirvg
aatetelkekkhrfedalnatraavee

SCOPe Domain Coordinates for d1we3e3:

Click to download the PDB-style file with coordinates for d1we3e3.
(The format of our PDB-style files is described here.)

Timeline for d1we3e3:

View in 3D
Domains from other chains:
(mouse over for more information)
d1we3a1, d1we3a2, d1we3a3, d1we3b1, d1we3b2, d1we3b3, d1we3c1, d1we3c2, d1we3c3, d1we3d1, d1we3d2, d1we3d3, d1we3f1, d1we3f2, d1we3f3, d1we3g1, d1we3g2, d1we3g3, d1we3h1, d1we3h2, d1we3h3, d1we3i1, d1we3i2, d1we3i3, d1we3j1, d1we3j2, d1we3j3, d1we3k1, d1we3k2, d1we3k3, d1we3l1, d1we3l2, d1we3l3, d1we3m1, d1we3m2, d1we3m3, d1we3n1, d1we3n2, d1we3n3, d1we3o_, d1we3p_, d1we3q_, d1we3r_, d1we3s_, d1we3t_, d1we3u_