Lineage for d1we3a3 (1we3 A:139-189,A:374-408)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 503734Fold d.56: GroEL-intermediate domain like [54848] (1 superfamily)
    3-helical bundle packed against 3-stranded mixed beta-sheet
  4. 503735Superfamily d.56.1: GroEL-intermediate domain like [54849] (2 families) (S)
  5. 503736Family d.56.1.1: GroEL-like chaperone, intermediate domain [54850] (1 protein)
  6. 503737Protein GroEL, I domain [54851] (3 species)
  7. 503853Species Thermus thermophilus [TaxId:274] [110940] (2 PDB entries)
  8. 503854Domain d1we3a3: 1we3 A:139-189,A:374-408 [109290]
    Other proteins in same PDB: d1we3a1, d1we3a2, d1we3b1, d1we3b2, d1we3c1, d1we3c2, d1we3d1, d1we3d2, d1we3e1, d1we3e2, d1we3f1, d1we3f2, d1we3g1, d1we3g2, d1we3h1, d1we3h2, d1we3i1, d1we3i2, d1we3j1, d1we3j2, d1we3k1, d1we3k2, d1we3l1, d1we3l2, d1we3m1, d1we3m2, d1we3n1, d1we3n2, d1we3o_, d1we3p_, d1we3q_, d1we3r_, d1we3s_, d1we3t_, d1we3u_

Details for d1we3a3

PDB Entry: 1we3 (more details), 2.8 Å

PDB Description: Crystal Structure of the Chaperonin Complex Cpn60/Cpn10/(ADP)7 from Thermus Thermophilus

SCOP Domain Sequences for d1we3a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1we3a3 d.56.1.1 (A:139-189,A:374-408) GroEL, I domain {Thermus thermophilus}
edrkaieevatisandpevgkliadamekvgkegiitveesksletelkfvXgvavirvg
aatetelkekkhrfedalnatraavee

SCOP Domain Coordinates for d1we3a3:

Click to download the PDB-style file with coordinates for d1we3a3.
(The format of our PDB-style files is described here.)

Timeline for d1we3a3:

View in 3D
Domains from other chains:
(mouse over for more information)
d1we3b1, d1we3b2, d1we3b3, d1we3c1, d1we3c2, d1we3c3, d1we3d1, d1we3d2, d1we3d3, d1we3e1, d1we3e2, d1we3e3, d1we3f1, d1we3f2, d1we3f3, d1we3g1, d1we3g2, d1we3g3, d1we3h1, d1we3h2, d1we3h3, d1we3i1, d1we3i2, d1we3i3, d1we3j1, d1we3j2, d1we3j3, d1we3k1, d1we3k2, d1we3k3, d1we3l1, d1we3l2, d1we3l3, d1we3m1, d1we3m2, d1we3m3, d1we3n1, d1we3n2, d1we3n3, d1we3o_, d1we3p_, d1we3q_, d1we3r_, d1we3s_, d1we3t_, d1we3u_