Lineage for d1we3a1 (1we3 A:3-138,A:409-527)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 648737Fold a.129: GroEL equatorial domain-like [48591] (1 superfamily)
    multihelical; 8 helices arranged in 2 parallel layers
  4. 648738Superfamily a.129.1: GroEL equatorial domain-like [48592] (2 families) (S)
    duplication: two 4-helical subdomains are related by a pseudo dyad passing through the ATP-binding site
  5. 648739Family a.129.1.1: GroEL chaperone, ATPase domain [48593] (1 protein)
  6. 648740Protein GroEL, E domain [48594] (4 species)
  7. 648865Species Thermus thermophilus [TaxId:274] [110024] (2 PDB entries)
  8. 648866Domain d1we3a1: 1we3 A:3-138,A:409-527 [109288]
    Other proteins in same PDB: d1we3a2, d1we3a3, d1we3b2, d1we3b3, d1we3c2, d1we3c3, d1we3d2, d1we3d3, d1we3e2, d1we3e3, d1we3f2, d1we3f3, d1we3g2, d1we3g3, d1we3h2, d1we3h3, d1we3i2, d1we3i3, d1we3j2, d1we3j3, d1we3k2, d1we3k3, d1we3l2, d1we3l3, d1we3m2, d1we3m3, d1we3n2, d1we3n3, d1we3o_, d1we3p_, d1we3q_, d1we3r_, d1we3s_, d1we3t_, d1we3u_

Details for d1we3a1

PDB Entry: 1we3 (more details), 2.8 Å

PDB Description: Crystal Structure of the Chaperonin Complex Cpn60/Cpn10/(ADP)7 from Thermus Thermophilus
PDB Compounds: (A:) cpn60(GroEL)

SCOP Domain Sequences for d1we3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1we3a1 a.129.1.1 (A:3-138,A:409-527) GroEL, E domain {Thermus thermophilus [TaxId: 274]}
akilvfdeaarralergvnavanavkvtlgprgrnvvlekkfgsptitkdgvtvakevel
edhlenigaqllkevasktndvagdgtttatvlaqaivreglknvaaganplalkrgiek
aveaavekikalaipvXgivpgggvtllraisaveelikklegdeatgakivrraleepa
rqiaenagyegsvivqqilaetknprygfnaatgefvdmveagivdpakvtrsalqnaas
igaliltteavvaekp

SCOP Domain Coordinates for d1we3a1:

Click to download the PDB-style file with coordinates for d1we3a1.
(The format of our PDB-style files is described here.)

Timeline for d1we3a1:

View in 3D
Domains from other chains:
(mouse over for more information)
d1we3b1, d1we3b2, d1we3b3, d1we3c1, d1we3c2, d1we3c3, d1we3d1, d1we3d2, d1we3d3, d1we3e1, d1we3e2, d1we3e3, d1we3f1, d1we3f2, d1we3f3, d1we3g1, d1we3g2, d1we3g3, d1we3h1, d1we3h2, d1we3h3, d1we3i1, d1we3i2, d1we3i3, d1we3j1, d1we3j2, d1we3j3, d1we3k1, d1we3k2, d1we3k3, d1we3l1, d1we3l2, d1we3l3, d1we3m1, d1we3m2, d1we3m3, d1we3n1, d1we3n2, d1we3n3, d1we3o_, d1we3p_, d1we3q_, d1we3r_, d1we3s_, d1we3t_, d1we3u_