Lineage for d1wdub_ (1wdu B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2594378Fold d.151: DNase I-like [56218] (1 superfamily)
    contains beta-sandwich; duplication of alpha+beta motif
  4. 2594379Superfamily d.151.1: DNase I-like [56219] (4 families) (S)
  5. 2594380Family d.151.1.1: DNase I-like [56220] (7 proteins)
  6. 2594436Protein Endonuclease domain of TRAS1 retrotransposon (ORF2) [111215] (1 species)
  7. 2594437Species Silkworm (Bombyx mori) [TaxId:7091] [111216] (1 PDB entry)
    Uniprot Q93139 1-184
  8. 2594439Domain d1wdub_: 1wdu B: [109287]
    complexed with cl, po4

Details for d1wdub_

PDB Entry: 1wdu (more details), 2.4 Å

PDB Description: Endonuclease domain of TRAS1, a telomere-specific non-LTR retrotransposon
PDB Compounds: (B:) TRAS1 ORF2p

SCOPe Domain Sequences for d1wdub_:

Sequence, based on SEQRES records: (download)

>d1wdub_ d.151.1.1 (B:) Endonuclease domain of TRAS1 retrotransposon (ORF2) {Silkworm (Bombyx mori) [TaxId: 7091]}
pyrvlqanlqrkklataelaieaatrkaaialiqepyvggaksmkgfrgvrvfqstaqgd
gtvkaaiavfdhdldviqypqlttnnivvvgirtraweitlvsyyfepdkpiesyleqik
rverkmgpkrlifggdanakstwwgskeddargdqlmgtlgelglhilnegdvptfdtir
ggkryqsrvdvtfctedmldlidgwrvdedlvssdhngmvfnirlqk

Sequence, based on observed residues (ATOM records): (download)

>d1wdub_ d.151.1.1 (B:) Endonuclease domain of TRAS1 retrotransposon (ORF2) {Silkworm (Bombyx mori) [TaxId: 7091]}
pyrvlqanlqrkklataelaieaatrkaaialiqepyvfrgvrvfqstaqgdgtvkaaia
vfdhdldviqypqlttnnivvvgirtraweitlvsyyfepdkpiesyleqikrverkmgp
krlifggdanakstwwgskeddargdqlmgtlgelglhilnegdvptfdtirggkryqsr
vdvtfctedmldlidgwrvdedlvssdhngmvfnirlqk

SCOPe Domain Coordinates for d1wdub_:

Click to download the PDB-style file with coordinates for d1wdub_.
(The format of our PDB-style files is described here.)

Timeline for d1wdub_: