Lineage for d1wdub_ (1wdu B:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 512728Fold d.151: DNase I-like [56218] (1 superfamily)
    contains beta-sandwich; duplication of alpha+beta motif
  4. 512729Superfamily d.151.1: DNase I-like [56219] (2 families) (S)
  5. 512730Family d.151.1.1: DNase I-like [56220] (6 proteins)
  6. 512759Protein Endonuclease domain of TRAS1 retrotransposon (ORF2) [111215] (1 species)
  7. 512760Species Silkworm (Bombyx mori) [TaxId:7091] [111216] (1 PDB entry)
  8. 512762Domain d1wdub_: 1wdu B: [109287]

Details for d1wdub_

PDB Entry: 1wdu (more details), 2.4 Å

PDB Description: Endonuclease domain of TRAS1, a telomere-specific non-LTR retrotransposon

SCOP Domain Sequences for d1wdub_:

Sequence, based on SEQRES records: (download)

>d1wdub_ d.151.1.1 (B:) Endonuclease domain of TRAS1 retrotransposon (ORF2) {Silkworm (Bombyx mori)}
pyrvlqanlqrkklataelaieaatrkaaialiqepyvggaksmkgfrgvrvfqstaqgd
gtvkaaiavfdhdldviqypqlttnnivvvgirtraweitlvsyyfepdkpiesyleqik
rverkmgpkrlifggdanakstwwgskeddargdqlmgtlgelglhilnegdvptfdtir
ggkryqsrvdvtfctedmldlidgwrvdedlvssdhngmvfnirlqk

Sequence, based on observed residues (ATOM records): (download)

>d1wdub_ d.151.1.1 (B:) Endonuclease domain of TRAS1 retrotransposon (ORF2) {Silkworm (Bombyx mori)}
pyrvlqanlqrkklataelaieaatrkaaialiqepyvfrgvrvfqstaqgdgtvkaaia
vfdhdldviqypqlttnnivvvgirtraweitlvsyyfepdkpiesyleqikrverkmgp
krlifggdanakstwwgskeddargdqlmgtlgelglhilnegdvptfdtirggkryqsr
vdvtfctedmldlidgwrvdedlvssdhngmvfnirlqk

SCOP Domain Coordinates for d1wdub_:

Click to download the PDB-style file with coordinates for d1wdub_.
(The format of our PDB-style files is described here.)

Timeline for d1wdub_: