Lineage for d1wdua_ (1wdu A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2548549Fold d.151: DNase I-like [56218] (1 superfamily)
    contains beta-sandwich; duplication of alpha+beta motif
  4. 2548550Superfamily d.151.1: DNase I-like [56219] (4 families) (S)
  5. 2548551Family d.151.1.1: DNase I-like [56220] (7 proteins)
  6. 2548603Protein Endonuclease domain of TRAS1 retrotransposon (ORF2) [111215] (1 species)
  7. 2548604Species Silkworm (Bombyx mori) [TaxId:7091] [111216] (1 PDB entry)
    Uniprot Q93139 1-184
  8. 2548605Domain d1wdua_: 1wdu A: [109286]
    complexed with cl, po4

Details for d1wdua_

PDB Entry: 1wdu (more details), 2.4 Å

PDB Description: Endonuclease domain of TRAS1, a telomere-specific non-LTR retrotransposon
PDB Compounds: (A:) TRAS1 ORF2p

SCOPe Domain Sequences for d1wdua_:

Sequence, based on SEQRES records: (download)

>d1wdua_ d.151.1.1 (A:) Endonuclease domain of TRAS1 retrotransposon (ORF2) {Silkworm (Bombyx mori) [TaxId: 7091]}
ppyrvlqanlqrkklataelaieaatrkaaialiqepyvggaksmkgfrgvrvfqstaqg
dgtvkaaiavfdhdldviqypqlttnnivvvgirtraweitlvsyyfepdkpiesyleqi
krverkmgpkrlifggdanakstwwgskeddargdqlmgtlgelglhilnegdvptfdti
rggkryqsrvdvtfctedmldlidgwrvdedlvssdhngmvfnirlqk

Sequence, based on observed residues (ATOM records): (download)

>d1wdua_ d.151.1.1 (A:) Endonuclease domain of TRAS1 retrotransposon (ORF2) {Silkworm (Bombyx mori) [TaxId: 7091]}
ppyrvlqanlqrkklataelaieaatrkaaialiqepyvkgfrgvrvfqstaqgdgtvka
aiavfdhdldviqypqlttnnivvvgirtraweitlvsyyfepdkpiesyleqikrverk
mgpkrlifggdanakstwwgskeddargdqlmgtlgelglhilnegdvptfdtryqsrvd
vtfctedmldlidgwrvdedlvssdhngmvfnirlqk

SCOPe Domain Coordinates for d1wdua_:

Click to download the PDB-style file with coordinates for d1wdua_.
(The format of our PDB-style files is described here.)

Timeline for d1wdua_: