SCOPe 2.08: Domain d1wdmd2: 1wdm D:264-391

Lineage for d1wdmd2 (1wdm D:264-391)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.1: Thiolase-related [53902] (20 proteins)

6. Protein Fatty oxidation complex beta subunit (3-ketoacyl-CoA thiolase), C-terminal domain [419023] (1 species)
7. Species Pseudomonas fragi [TaxId:296] [419505] (4 PDB entries)
   Uniprot P28790

8. Domain d1wdmd2: 1wdm D:264-391 [109285]
   Other proteins in same PDB: d1wdma1, d1wdma2, d1wdma3, d1wdma4, d1wdmb1, d1wdmb2, d1wdmb3, d1wdmb4, d1wdmc1, d1wdmd1
   complexed with aco, nad, zn

Details for d1wdmd2

PDB Entry: 1wdm, 3.8 Å

PDB Description: fatty acid beta-oxidation multienzyme complex from Pseudomonas fragi, form I (native3)

PDB Compounds: (D:) 3-ketoacyl-CoA thiolase

SCOPe Domain Sequences for d1wdmd2:

Sequence; same for both SEQRES and ATOM records:

>d1wdmd2 c.95.1.1 (D:264-391) Fatty oxidation complex beta subunit (3-ketoacyl-CoA thiolase), C-terminal domain {Pseudomonas fragi [TaxId: 296]}
gleplavirsmavagvdpaimgygpvpatqkalkraglnmadidfielneafaaqalpvl
kdlkvldkmnekvnlhggaialghpfgcsgarisgtllnvmkqnggtfglstmciglgqg
iatvferv

Timeline for d1wdmd2:

• d1wdmd2 first appeared in SCOP 1.69
  
• d1wdmd2 appears in SCOPe 2.07