Lineage for d1wdmc2 (1wdm C:264-391)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2523777Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2523778Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2523779Family c.95.1.1: Thiolase-related [53902] (10 proteins)
  6. 2524164Protein Fatty oxidation complex beta subunit (3-ketoacyl-CoA thiolase) [110756] (1 species)
  7. 2524165Species Pseudomonas fragi [TaxId:296] [110757] (4 PDB entries)
    Uniprot P28790
  8. 2524179Domain d1wdmc2: 1wdm C:264-391 [109283]
    Other proteins in same PDB: d1wdma1, d1wdma2, d1wdma3, d1wdma4, d1wdmb1, d1wdmb2, d1wdmb3, d1wdmb4
    complexed with aco, nad, zn

Details for d1wdmc2

PDB Entry: 1wdm (more details), 3.8 Å

PDB Description: fatty acid beta-oxidation multienzyme complex from Pseudomonas fragi, form I (native3)
PDB Compounds: (C:) 3-ketoacyl-CoA thiolase

SCOPe Domain Sequences for d1wdmc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wdmc2 c.95.1.1 (C:264-391) Fatty oxidation complex beta subunit (3-ketoacyl-CoA thiolase) {Pseudomonas fragi [TaxId: 296]}
gleplavirsmavagvdpaimgygpvpatqkalkraglnmadidfielneafaaqalpvl
kdlkvldkmnekvnlhggaialghpfgcsgarisgtllnvmkqnggtfglstmciglgqg
iatvferv

SCOPe Domain Coordinates for d1wdmc2:

Click to download the PDB-style file with coordinates for d1wdmc2.
(The format of our PDB-style files is described here.)

Timeline for d1wdmc2: