| Class c: Alpha and beta proteins (a/b) [51349] (136 folds) |
| Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
Superfamily c.95.1: Thiolase-like [53901] (2 families) ![]() |
| Family c.95.1.1: Thiolase-related [53902] (7 proteins) |
| Protein Fatty oxidation complex beta subunit (3-ketoacyl-CoA thiolase) [110756] (1 species) |
| Species Pseudomonas fragi [TaxId:296] [110757] (3 PDB entries) |
| Domain d1wdmc2: 1wdm C:264-391 [109283] Other proteins in same PDB: d1wdma1, d1wdma2, d1wdma3, d1wdma4, d1wdmb1, d1wdmb2, d1wdmb3, d1wdmb4 |
PDB Entry: 1wdm (more details), 3.8 Å
SCOP Domain Sequences for d1wdmc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wdmc2 c.95.1.1 (C:264-391) Fatty oxidation complex beta subunit (3-ketoacyl-CoA thiolase) {Pseudomonas fragi}
gleplavirsmavagvdpaimgygpvpatqkalkraglnmadidfielneafaaqalpvl
kdlkvldkmnekvnlhggaialghpfgcsgarisgtllnvmkqnggtfglstmciglgqg
iatvferv
Timeline for d1wdmc2: