Lineage for d1wdmc1 (1wdm C:2-263)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2916469Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2916470Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2916471Family c.95.1.1: Thiolase-related [53902] (20 proteins)
  6. 2916884Protein Fatty oxidation complex beta subunit (3-ketoacyl-CoA thiolase), N-terminal domain [419022] (1 species)
  7. 2916885Species Pseudomonas fragi [TaxId:296] [419504] (4 PDB entries)
    Uniprot P28790
  8. 2916892Domain d1wdmc1: 1wdm C:2-263 [109282]
    Other proteins in same PDB: d1wdma1, d1wdma2, d1wdma3, d1wdma4, d1wdmb1, d1wdmb2, d1wdmb3, d1wdmb4, d1wdmc2, d1wdmd2
    complexed with aco, nad, zn
    has additional insertions and/or extensions that are not grouped together

Details for d1wdmc1

PDB Entry: 1wdm (more details), 3.8 Å

PDB Description: fatty acid beta-oxidation multienzyme complex from Pseudomonas fragi, form I (native3)
PDB Compounds: (C:) 3-ketoacyl-CoA thiolase

SCOPe Domain Sequences for d1wdmc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wdmc1 c.95.1.1 (C:2-263) Fatty oxidation complex beta subunit (3-ketoacyl-CoA thiolase), N-terminal domain {Pseudomonas fragi [TaxId: 296]}
slnprdvvivdfgrtpmgrskggmhrntraedmsahliskvlernskvdpgevedviwgc
vnqtleqgwniarmaslmtqiphtsaaqtvsrlcgssmsalhtaaqaimtgngdvfvvgg
vehmghvsmmhgvdpnphmslyaakasgmmgltaemlgkmhgisreqqdafavrshqlah
katvegkfkdeiipmqgydengflkifdydetirpdttleslaalkpafnpkggtvtagt
ssqitdgascmivmsaqrakdl

SCOPe Domain Coordinates for d1wdmc1:

Click to download the PDB-style file with coordinates for d1wdmc1.
(The format of our PDB-style files is described here.)

Timeline for d1wdmc1: