Lineage for d1wdmb4 (1wdm B:1-310)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 480393Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 480394Superfamily c.14.1: ClpP/crotonase [52096] (4 families) (S)
  5. 480448Family c.14.1.3: Crotonase-like [52103] (8 proteins)
  6. 480527Protein Fatty oxidation complex alpha subunit, N-terminal domain [110450] (1 species)
  7. 480528Species Pseudomonas fragi [TaxId:296] [110451] (3 PDB entries)
  8. 480534Domain d1wdmb4: 1wdm B:1-310 [109281]
    Other proteins in same PDB: d1wdma1, d1wdma2, d1wdma3, d1wdmb1, d1wdmb2, d1wdmb3, d1wdmc1, d1wdmc2, d1wdmd1, d1wdmd2

Details for d1wdmb4

PDB Entry: 1wdm (more details), 3.8 Å

PDB Description: fatty acid beta-oxidation multienzyme complex from Pseudomonas fragi, form I (native3)

SCOP Domain Sequences for d1wdmb4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wdmb4 c.14.1.3 (B:1-310) Fatty oxidation complex alpha subunit, N-terminal domain {Pseudomonas fragi}
miyegkaitvtalesgivelkfdlkgesvnkfnrltlnelrqavdaikadasvkgvivss
gkdvfivgaditefvenfklpdaeliagnleankifsdfedlnvptvaaingialgggle
mclaadfrvmadsakiglpevklgiypgfggtvrlprligvdnavewiasgkenraedal
kvsavdavvtadklgaaaldlikraisgeldykakrqpkleklklnaieqmmafetakgf
vagqagpnypapveaiktiqkaanfgrdkaleveaagfaklaktsasncliglflndqel
kkkakvydki

SCOP Domain Coordinates for d1wdmb4:

Click to download the PDB-style file with coordinates for d1wdmb4.
(The format of our PDB-style files is described here.)

Timeline for d1wdmb4: