Class a: All alpha proteins [46456] (289 folds) |
Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily) multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry |
Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) N-terminal domain is Rossmann-fold with a family-specific C-terminal extension |
Family a.100.1.3: HCDH C-domain-like [48187] (2 proteins) |
Protein Fatty oxidation complex alpha subunit, C-terminal domain [109949] (1 species) duplication: contains two repeats of this domain |
Species Pseudomonas fragi [TaxId:296] [109950] (4 PDB entries) Uniprot P28793 |
Domain d1wdmb2: 1wdm B:621-715 [109279] Other proteins in same PDB: d1wdma3, d1wdma4, d1wdmb3, d1wdmb4, d1wdmc1, d1wdmc2, d1wdmd1, d1wdmd2 complexed with aco, nad, zn |
PDB Entry: 1wdm (more details), 3.8 Å
SCOPe Domain Sequences for d1wdmb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wdmb2 a.100.1.3 (B:621-715) Fatty oxidation complex alpha subunit, C-terminal domain {Pseudomonas fragi [TaxId: 296]} dvtdediinwmmiplcletvrcledgivetaaeadmglvygigfplfrggalryidsigv aefvaladqyaelgalyhptaklremakngqsffg
Timeline for d1wdmb2: