Lineage for d1wdmb2 (1wdm B:621-715)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2334421Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
    multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry
  4. 2334422Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) (S)
    N-terminal domain is Rossmann-fold with a family-specific C-terminal extension
  5. 2334484Family a.100.1.3: HCDH C-domain-like [48187] (2 proteins)
  6. 2334485Protein Fatty oxidation complex alpha subunit, C-terminal domain [109949] (1 species)
    duplication: contains two repeats of this domain
  7. 2334486Species Pseudomonas fragi [TaxId:296] [109950] (4 PDB entries)
    Uniprot P28793
  8. 2334502Domain d1wdmb2: 1wdm B:621-715 [109279]
    Other proteins in same PDB: d1wdma3, d1wdma4, d1wdmb3, d1wdmb4, d1wdmc1, d1wdmc2, d1wdmd1, d1wdmd2
    complexed with aco, nad, zn

Details for d1wdmb2

PDB Entry: 1wdm (more details), 3.8 Å

PDB Description: fatty acid beta-oxidation multienzyme complex from Pseudomonas fragi, form I (native3)
PDB Compounds: (B:) Fatty oxidation complex alpha subunit

SCOPe Domain Sequences for d1wdmb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wdmb2 a.100.1.3 (B:621-715) Fatty oxidation complex alpha subunit, C-terminal domain {Pseudomonas fragi [TaxId: 296]}
dvtdediinwmmiplcletvrcledgivetaaeadmglvygigfplfrggalryidsigv
aefvaladqyaelgalyhptaklremakngqsffg

SCOPe Domain Coordinates for d1wdmb2:

Click to download the PDB-style file with coordinates for d1wdmb2.
(The format of our PDB-style files is described here.)

Timeline for d1wdmb2: