Lineage for d1wdma3 (1wdm A:311-496)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2844998Family c.2.1.6: 6-phosphogluconate dehydrogenase-like, N-terminal domain [51868] (19 proteins)
    the beta-sheet is extended to 8 strands, order 32145678; strands 7 & 8 are antiparallel to the rest
    C-terminal domains also show some similarity
  6. 2845043Protein Fatty oxidation complex alpha subunit, middle domain [110432] (1 species)
  7. 2845044Species Pseudomonas fragi [TaxId:296] [110433] (4 PDB entries)
    Uniprot P28793
  8. 2845051Domain d1wdma3: 1wdm A:311-496 [109276]
    Other proteins in same PDB: d1wdma1, d1wdma2, d1wdma4, d1wdmb1, d1wdmb2, d1wdmb4, d1wdmc1, d1wdmc2, d1wdmd1, d1wdmd2
    complexed with aco, nad, zn

Details for d1wdma3

PDB Entry: 1wdm (more details), 3.8 Å

PDB Description: fatty acid beta-oxidation multienzyme complex from Pseudomonas fragi, form I (native3)
PDB Compounds: (A:) Fatty oxidation complex alpha subunit

SCOPe Domain Sequences for d1wdma3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wdma3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]}
akdvkqaavlgagimgggiayqsaskgtpilmkdinehgieqglaeaakllvgrvdkgrm
tpakmaevlngirptlsygdfgnvdlvveavvenpkvkqavlaevenhvredailasnts
tisisllakalkrpenfvgmhffnpvhmmplvevirgekssdlavattvayakkmgknpi
vvndcp

SCOPe Domain Coordinates for d1wdma3:

Click to download the PDB-style file with coordinates for d1wdma3.
(The format of our PDB-style files is described here.)

Timeline for d1wdma3: