Lineage for d1wdld1 (1wdl D:2-263)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 495246Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 495247Superfamily c.95.1: Thiolase-like [53901] (2 families) (S)
  5. 495248Family c.95.1.1: Thiolase-related [53902] (7 proteins)
  6. 495482Protein Fatty oxidation complex beta subunit (3-ketoacyl-CoA thiolase) [110756] (1 species)
  7. 495483Species Pseudomonas fragi [TaxId:296] [110757] (3 PDB entries)
  8. 495490Domain d1wdld1: 1wdl D:2-263 [109272]
    Other proteins in same PDB: d1wdla1, d1wdla2, d1wdla3, d1wdla4, d1wdlb1, d1wdlb2, d1wdlb3, d1wdlb4

Details for d1wdld1

PDB Entry: 1wdl (more details), 3.5 Å

PDB Description: fatty acid beta-oxidation multienzyme complex from Pseudomonas fragi, form II (native4)

SCOP Domain Sequences for d1wdld1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wdld1 c.95.1.1 (D:2-263) Fatty oxidation complex beta subunit (3-ketoacyl-CoA thiolase) {Pseudomonas fragi}
slnprdvvivdfgrtpmgrskggmhrntraedmsahliskvlernskvdpgevedviwgc
vnqtleqgwniarmaslmtqiphtsaaqtvsrlcgssmsalhtaaqaimtgngdvfvvgg
vehmghvsmmhgvdpnphmslyaakasgmmgltaemlgkmhgisreqqdafavrshqlah
katvegkfkdeiipmqgydengflkifdydetirpdttleslaalkpafnpkggtvtagt
ssqitdgascmivmsaqrakdl

SCOP Domain Coordinates for d1wdld1:

Click to download the PDB-style file with coordinates for d1wdld1.
(The format of our PDB-style files is described here.)

Timeline for d1wdld1: