SCOPe 2.08: Domain d1wdld1: 1wdl D:2-263

Lineage for d1wdld1 (1wdl D:2-263)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.1: Thiolase-related [53902] (20 proteins)

6. Protein Fatty oxidation complex beta subunit (3-ketoacyl-CoA thiolase), N-terminal domain [419022] (1 species)

7. Species Pseudomonas fragi [TaxId:296] [419504] (4 PDB entries)
   Uniprot P28790

8. Domain d1wdld1: 1wdl D:2-263 [109272]
   Other proteins in same PDB: d1wdla1, d1wdla2, d1wdla3, d1wdla4, d1wdlb1, d1wdlb2, d1wdlb3, d1wdlb4, d1wdlc2, d1wdld2
   complexed with aco, n8e, nad
   has additional insertions and/or extensions that are not grouped together

Details for d1wdld1

PDB Entry: 1wdl, 3.5 Å

PDB Description: fatty acid beta-oxidation multienzyme complex from Pseudomonas fragi, form II (native4)

PDB Compounds: (D:) 3-ketoacyl-CoA thiolase

SCOPe Domain Sequences for d1wdld1:

Sequence; same for both SEQRES and ATOM records:

>d1wdld1 c.95.1.1 (D:2-263) Fatty oxidation complex beta subunit (3-ketoacyl-CoA thiolase), N-terminal domain {Pseudomonas fragi [TaxId: 296]}
slnprdvvivdfgrtpmgrskggmhrntraedmsahliskvlernskvdpgevedviwgc
vnqtleqgwniarmaslmtqiphtsaaqtvsrlcgssmsalhtaaqaimtgngdvfvvgg
vehmghvsmmhgvdpnphmslyaakasgmmgltaemlgkmhgisreqqdafavrshqlah
katvegkfkdeiipmqgydengflkifdydetirpdttleslaalkpafnpkggtvtagt
ssqitdgascmivmsaqrakdl

Timeline for d1wdld1:

• d1wdld1 first appeared in SCOP 1.69
  
• d1wdld1 appears in SCOPe 2.07